SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800931|ref|YP_695975.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800931|ref|YP_695975.1|
Domain Number 1 Region: 10-202
Classification Level Classification E-value
Superfamily MetI-like 3.05e-45
Family MetI-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800931|ref|YP_695975.1|
Sequence length 213
Comment His/Glu/Gln/Arg/opine ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MNYIITLMPSIIEGLKNTLGVFILTLLLSIPLGIIVAILRLSNIKIVNFISSLYVLVMRG
TPLLLQLIFIFFGLPIIGVSIDRFPAAIIAFTLNYAAYFGEIFRSGIKDIDRGQFEASKI
LGLSKWFTFKKIILPQSFKKTLPSIANEVITLVKDTSLVYVVGIGELLRAGKIASNRDAS
LLPLFLIGIIYLLLIGILTKIFNRLEKKYSYYN
Download sequence
Identical sequences A0A0H2YV85 A0A174A8S8 Q8XKR9
195102.CPE1325 195103.CPF_1532 WP_003481390.1.10161 WP_003481390.1.2058 WP_003481390.1.20964 WP_003481390.1.22226 WP_003481390.1.30163 WP_003481390.1.32463 WP_003481390.1.43003 WP_003481390.1.50147 WP_003481390.1.52260 WP_003481390.1.5234 WP_003481390.1.52659 WP_003481390.1.68380 WP_003481390.1.81392 gi|110800931|ref|YP_695975.1| gi|18310307|ref|NP_562241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]