SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800947|ref|YP_696316.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800947|ref|YP_696316.1|
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily RbsD-like 1.44e-45
Family RbsD-like 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110800947|ref|YP_696316.1|
Sequence length 131
Comment D-ribose pyranase [Clostridium perfringens ATCC 13124]
Sequence
MRKTSLLNSNISSVISKMGHTDMLAIGDCGLPIPKETERIDLALIKGVPGFIETLKAILE
ELQVEEVLIAKETEKVSPELFTEIKEIIKDTKITFISHEELKKELKDCKAVVRTGEQTPY
ANIILKSGVVF
Download sequence
Identical sequences A0A173Z2F9 B1BVY3 B1R4U7 B1V4W8 Q0TPX4
gi|110800947|ref|YP_696316.1| 195103.CPF_1883 WP_003456057.1.100517 WP_003456057.1.10161 WP_003456057.1.2058 WP_003456057.1.20964 WP_003456057.1.23119 WP_003456057.1.27537 WP_003456057.1.30163 WP_003456057.1.31832 WP_003456057.1.43003 WP_003456057.1.4402 WP_003456057.1.50147 WP_003456057.1.50713 WP_003456057.1.51349 WP_003456057.1.52260 WP_003456057.1.5234 WP_003456057.1.52659 WP_003456057.1.5667 WP_003456057.1.68380 WP_003456057.1.81392 WP_003456057.1.90682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]