SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800980|ref|YP_696200.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800980|ref|YP_696200.1|
Domain Number 1 Region: 919-1087
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-43
Family Histidine kinase 0.00035
Further Details:      
 
Domain Number 2 Region: 465-637
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 2.45e-17
Family SGL-like 0.028
Further Details:      
 
Domain Number 3 Region: 61-263
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.45e-17
Family SGL-like 0.015
Further Details:      
 
Domain Number 4 Region: 845-930
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000785
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Domain Number 5 Region: 264-479
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000000000157
Family SGL-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800980|ref|YP_696200.1|
Sequence length 1093
Comment sensor histidine kinase/response regulator [Clostridium perfringens ATCC 13124]
Sequence
MNIKKLVIRYAFLSLILILIQGKNVFALGESEVRFNNLTLKDGLSQSTVNKIIQDNKGYM
WFGTSDGLNKYNGHEFVIFRELVNDKKSINSSFISALIEYDNDNILVGTSKGISKINVIT
NEVSRMFEDEEGKSKLSNNNIWDILKHSDGTIWIATRKGLNIYNPKTGDMYQIFKDTEPK
GLKSNVVTSLCEDKYGNVWVGTSEGLSVINTKTKEIQPINDILDNDNSAISNIYRDRDDN
IWIVTDNHIMLVSSNYKDITYFDKELESFKISPDSVNAIYEDKYNNLWISTQNGLLEYNK
ENKKMHLFESRYYDDTSLVNDNVLTAYEDRSGLLWFGTYNGISLLNPKQPFKHYRREPDK
ENTISDNSMSGIYKDSDGMLWLGTNSAGLNKLNTMTGEVTNFYSNNSDENTLSSNVVWQI
CEADKDNLWVATQGGVNKINKKSGNVERLKYPDNMRERNKMDARNVFVDKDGLLWIGARG
GLQSYDDKTGTFTDYSNVFKAVGIVENAVTSISQDEEGFLWITIGIDGGVVKFDKDKGVL
KSYLNNSFDSNSLINNGVRCLEKDSKGNVWIGTEAGLSKLDPKTDKFTNYTVVNGLANNF
IYGILIDEEDNLWISTNDGLSRFDQKTNKFINYTAMDGLQSNEFNGRSYFKSKDGEMFFG
GINGVTAFYPKDVLKLSDNRNKSKVVIDEIKVNNKTYPYYGGTLSLKYNENNISIDFFLP
DYLNTTKTTYEYKLEGVDEEWTFANKRNNANYATLDSGTYKVLIRARDNHGDLTPVTALD
LKIAPPPWRTPTAYLIYFSSAVIVIFLMWSYVTALEKTVKKRAEQLKKEAKEKEKLYIEK
EKLYKEAADLKDEMIKRQKFKNDYFVNLSHELRTPLNVILATVQLIKLKNKEDCLGKYQV
EDYTNTLRNNADHLLKIINDIIDSSKIESGAYKLNIEKQDIVSLVEDTALSLKAYIEENN
LDIIIDPEIEELDVECDKNEIERCVINLLSNAIKYTHGYGTIEVFIRECENETVEIAIKD
TGVGISKEQQKIIFDRFVQADSISKKQYRSSGIGLTLVKSIIELHHGTIRVESELNKGST
FIITLPIRQEKSK
Download sequence
Identical sequences A0A0H2YU34
WP_011590867.1.50147 NYSGRC-SEC-110800980 195103.CPF_1764 gi|110800980|ref|YP_696200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]