SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800991|ref|YP_697031.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800991|ref|YP_697031.1|
Domain Number 1 Region: 65-301
Classification Level Classification E-value
Superfamily MetI-like 1.83e-53
Family MetI-like 0.00000114
Further Details:      
 
Domain Number 2 Region: 22-59
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.000000000575
Family MalF N-terminal region-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800991|ref|YP_697031.1|
Sequence length 317
Comment maltose/maltodextrin ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MQVASDRRADKKHKRLKDTIKAMPYLLPAVISIIIFTIIPIVYTIVIAFTDYTMYSQGNI
KFVGFANFIEVLTGPFKEVFLPVFGWNIIFAVVSTAGTFFLGLIVAMAVNNPNIKEKSVY
RAILIIPWALPATVAILSWQGLLNGSYGAINNLLLNLHLISNPIPWLTDPTWARVALIIV
NIWLGFPYMMNVCLGALGAIPDSYYEAADVDGASKWLQFRKITLPSLAQISYPLLISSFA
FNFNNFGSAFLITKGGPPRMATQFAGYTDILASVNYKLSTQFGRFEIASAISIIIFLILG
TISYYQMKLSGQFEEVE
Download sequence
Identical sequences A0A0H2YU61 A0A174FH99 B1R7P2
195103.CPF_2651 WP_003457841.1.10161 WP_003457841.1.2058 WP_003457841.1.20964 WP_003457841.1.27537 WP_003457841.1.30163 WP_003457841.1.50147 WP_003457841.1.52260 WP_003457841.1.5234 WP_003457841.1.52659 WP_003457841.1.68380 WP_003457841.1.81392 gi|110800991|ref|YP_697031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]