SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800993|ref|YP_697276.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800993|ref|YP_697276.1|
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 8.46e-52
Family Galactoside acetyltransferase-like 0.000000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800993|ref|YP_697276.1|
Sequence length 195
Comment maltose transacetylase [Clostridium perfringens ATCC 13124]
Sequence
MAMTEKEKMILGLPYNPADPELTKGRIRARILFQKFNKLDLPDNEEKADKTFKERSSILK
ELLGSTGESIYMEPNFKCDYGYNISVGNNFYANFDCVMLDVCKITIGENCFFAPGVHIYT
ATHPIDPIERLNYEFGKPVTIGNNVWIGGHATINPGVTIGNNVVVASGAVVTKDVPDNVV
VGGNPAKIIKKVCAK
Download sequence
Identical sequences A0A0H2YUY2
IDP04551 195103.CPF_2912 gi|110800993|ref|YP_697276.1| WP_011591177.1.20964 WP_011591177.1.30163 WP_011591177.1.50147 WP_011591177.1.52260 WP_011591177.1.5234 WP_011591177.1.52659 WP_011591177.1.68380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]