SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801006|ref|YP_695011.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801006|ref|YP_695011.1|
Domain Number 1 Region: 52-284
Classification Level Classification E-value
Superfamily MetI-like 5.49e-55
Family MetI-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801006|ref|YP_695011.1|
Sequence length 308
Comment ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MNSNKRKIFLAMCVLPALILFTIFMLYPIGKGFMMSLYEWSGISGEPVFVGLDNFKALLN
DRYFKEAFGNTFFIIVLFPAITITLSLFLAVVITQSKLKEKNFYRVILFFPNILSMVVIG
VLFTYVYDPSIGILKAFFEMIGLDKLAGLAWLGDSKLVLWALVITMVWQAVGYYMVIYIA
GLDGISPSLYEVCYLEGASAWQKFRYVTLPLLWDVVRVTFAFFITGALNLSFIFVTVMTK
GGPNGKSEVLLTYMYKQAFTNSQYGYAMAVGVTIFAFAMILALIINKLSDSDAREEKRVK
RLQQKGVI
Download sequence
Identical sequences A0A0H2YVF9
WP_011590256.1.50147 gi|110801006|ref|YP_695011.1| 195103.CPF_0557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]