SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801106|ref|YP_696244.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801106|ref|YP_696244.1|
Domain Number 1 Region: 1-322,456-497
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-52
Family FAD-linked reductases, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110801106|ref|YP_696244.1|
Sequence length 499
Comment phytoene dehydrogenase [Clostridium perfringens ATCC 13124]
Sequence
MSPNKKAIIVGAGIGGLATAVRLLINNFEVDIFEKNSKIGGKVNLIEYKDFKIDSSASIF
MLPKPYLEVFKYAKKDPKDYIELVELNTLYKVFNDEGDSFNIYSDFLKTTESLEKVFNDE
SSNYYKYISDSYRRYLLVEKYFLNRSFFTLNYWRYFKSLPELIKIHPFKNCYKTIEEYIS
NEYLKNLLAFQCMYIGESPLKSSNVFNLIPSTTQIYGLYYIKGGMYSYVKALEKLILELG
GKIHLNSNVTNILMEKNVAIGAKINHENIFSDLIVCNSDFTYTIQNLLPRSTFKNKISRR
KQNNLSFSCSTFILHLFLKKKYKNLDVHNIVLNLNKKEVLLAPFIDGPLPKEYIYYIYCP
SSIDTSLTPEDCECINITVRVPNLKKYKSKWTESTIVSLRNKILYDLSKIKGLEDIKENI
IYESYTTPMTLKNDFNCFFGAAFGLNHNLLQTTIFRPQAKIKKLKNIYFVGDSVHPGSGI
SMSLISAKLCCEKIISDFS
Download sequence
Identical sequences A0A0H2YUH4
NYSGRC-SEC-110801106 WP_003468037.1.100517 WP_003468037.1.27257 WP_003468037.1.31832 WP_003468037.1.39851 WP_003468037.1.4402 WP_003468037.1.50147 gi|110801106|ref|YP_696244.1| 195103.CPF_1810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]