SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801129|ref|YP_695012.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801129|ref|YP_695012.1|
Domain Number 1 Region: 20-293
Classification Level Classification E-value
Superfamily MetI-like 5.79e-69
Family MetI-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110801129|ref|YP_695012.1|
Sequence length 293
Comment ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MLETKKRKNVGLDTENKTKKVISNTLLRIILIAATILVIVPIIWTIMSSFKTTKEFYASP
WALPKSFGFANYMTAFTEANMGAYFFNSILVTIIAMVLSLCLSVPASYVLARQKFFGCSF
IKNLFMAGLFIQPVYIIVPLFTILEKMKLLNNLFALALVYAVLSLPFSIYIMSGFMKGIA
KDYEEAAMIDGCTNLQILTKIVVPLAKPGIITIMIFNFMNYWNEYAMAMTFITDADKKTL
PVGLQNLMEVQKFATDWGALFAGLVIVMVPTMVIYSLVHKKLTEGVNIGGVKG
Download sequence
Identical sequences A0A0H2YUM3 A0A127EFU6 B1BH31 B1R7E4 B1V662
195103.CPF_0558 gi|110801129|ref|YP_695012.1| WP_003449831.1.100517 WP_003449831.1.10161 WP_003449831.1.1075 WP_003449831.1.13323 WP_003449831.1.1394 WP_003449831.1.14338 WP_003449831.1.17789 WP_003449831.1.2058 WP_003449831.1.22226 WP_003449831.1.23119 WP_003449831.1.24595 WP_003449831.1.27257 WP_003449831.1.27360 WP_003449831.1.27537 WP_003449831.1.28470 WP_003449831.1.28529 WP_003449831.1.29129 WP_003449831.1.29428 WP_003449831.1.31832 WP_003449831.1.3228 WP_003449831.1.39851 WP_003449831.1.43003 WP_003449831.1.4345 WP_003449831.1.4402 WP_003449831.1.44743 WP_003449831.1.48074 WP_003449831.1.4818 WP_003449831.1.50147 WP_003449831.1.50713 WP_003449831.1.51349 WP_003449831.1.64066 WP_003449831.1.66593 WP_003449831.1.67534 WP_003449831.1.76352 WP_003449831.1.78174 WP_003449831.1.81392 WP_003449831.1.83225 WP_003449831.1.85755 WP_003449831.1.87374 WP_003449831.1.93653 WP_003449831.1.96543 WP_003449831.1.98368 WP_003449831.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]