SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801137|ref|YP_697167.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801137|ref|YP_697167.1|
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 3.68e-34
Family Prokaryotic DNA-bending protein 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110801137|ref|YP_697167.1|
Sequence length 91
Comment DNA-binding protein HU [Clostridium perfringens ATCC 13124]
Sequence
MNKAELITSMAEKSNLTKKDAELALKAFIESVSETLENGDKVQLVGFGTFETRVRAEREG
RNPRTKEVIKIPASIAPVFKPGKELKERVNA
Download sequence
Identical sequences A0A0H2YUJ1 A0A133N9A1 B1BHW1 Q0SQ72 Q8XHK4
gi|18311461|ref|NP_563395.1| gi|110801137|ref|YP_697167.1| 195102.CPE2479 195103.CPF_2802 289380.CPR_2488 gi|110803022|ref|YP_699735.1| WP_003450698.1.100517 WP_003450698.1.10161 WP_003450698.1.1075 WP_003450698.1.13323 WP_003450698.1.1394 WP_003450698.1.14338 WP_003450698.1.17789 WP_003450698.1.2058 WP_003450698.1.20964 WP_003450698.1.22226 WP_003450698.1.23119 WP_003450698.1.24595 WP_003450698.1.27257 WP_003450698.1.27360 WP_003450698.1.28470 WP_003450698.1.28529 WP_003450698.1.29129 WP_003450698.1.29428 WP_003450698.1.30163 WP_003450698.1.31832 WP_003450698.1.3228 WP_003450698.1.32463 WP_003450698.1.35472 WP_003450698.1.39851 WP_003450698.1.43003 WP_003450698.1.4345 WP_003450698.1.4402 WP_003450698.1.44743 WP_003450698.1.48074 WP_003450698.1.4818 WP_003450698.1.50147 WP_003450698.1.51349 WP_003450698.1.52260 WP_003450698.1.5234 WP_003450698.1.52659 WP_003450698.1.5667 WP_003450698.1.64066 WP_003450698.1.66593 WP_003450698.1.67534 WP_003450698.1.68380 WP_003450698.1.76352 WP_003450698.1.78174 WP_003450698.1.81392 WP_003450698.1.83225 WP_003450698.1.85755 WP_003450698.1.87374 WP_003450698.1.93653 WP_003450698.1.96543 WP_003450698.1.98368 WP_003450698.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]