SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801153|ref|YP_697038.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801153|ref|YP_697038.1|
Domain Number 1 Region: 97-292,469-529
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.74e-37
Family HI0933 N-terminal domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110801153|ref|YP_697038.1|
Sequence length 533
Comment hypothetical protein CPF_2658 [Clostridium perfringens ATCC 13124]
Sequence
MTIRINNISLDINEDLSLLKNKVAKKLRMSKDEIGDIKIIKESLDARKKNLIKFNYCINI
EHEDEEKIVARLNDKDVKIDKVNYDFDFNFGEKKLQHRPVVVGLGPAGLFAALLLAKKGF
NPIVFERGEDVDSRTKTVEEFWRTGELNPESNVQFGEGGAGAFSDGKLTTRIKDTRCDYV
LDALVRNGAPEEIIYKGKPHVGTDILKNVVKNIREEIKRNGGEVHFNSRFEGIIKKDNKL
KGIKVNGEEVPCEVAILALGHSSRDTYEMLFNEGVFMKQKPFAIGVRIEHPQEIINLSQY
GEKYANHPRLKAAEYRLAYQSKTLDRAVYSFCMCPGGVVVNASSEEKRLCVNGMSYHARD
KENANSALVVTVGPNDFGGDHPLEGMKFQRHYEELAFKLGGGNYNTPVQLVGDFMKDRVT
TKLGKVNPSVLSNGYRFEDLRKCLPSYVIDGLKEGITDFDRKIKGFGHSDSVLTGIETRT
SAPVRIERNEKLQSISLEGLYPAGEGAGFAGGIVSAAVDGLKVAENIMKEYRV
Download sequence
Identical sequences A0A0H2YV92 B1R7N5 Q9LBW2
195103.CPF_2658 gi|110801153|ref|YP_697038.1| WP_003457870.1.10161 WP_003457870.1.2058 WP_003457870.1.20964 WP_003457870.1.27537 WP_003457870.1.30163 WP_003457870.1.39851 WP_003457870.1.50147 WP_003457870.1.52260 WP_003457870.1.52659 WP_003457870.1.68380 WP_003457870.1.81392 WP_003457870.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]