SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801166|ref|YP_697211.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801166|ref|YP_697211.1|
Domain Number 1 Region: 3-348
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.66e-119
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 351-558
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 6.17e-42
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00023
Further Details:      
 
Domain Number 3 Region: 543-644
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.32e-32
Family Myf domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110801166|ref|YP_697211.1|
Sequence length 645
Comment methionyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
Sequence
MCKKPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERI
ANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYK
DSYEGLYCTPCESFWTETQLVNGNCPDCGRPVEKAKEEAYFFKMSKYADRLIQYIEEHPD
FIQPESRKNEMLNNFLRPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGY
GQEDQELYKKFWPADVHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMS
KSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSR
TIAMVYKYFDGVIQAPTCKEAIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRA
NKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKIDAQLNTKVT
TWESLKEFNGTVAGDKVVKGDVIFPRIDVEEKLAELEALKQAPVKPANEELVKNPIKEEI
TIDDFDKIDLRVVKVLECEPVKKAKKLLKLKVDLGGEERQVISGIAQYYKPEELVGKYVV
LVANLKPVKLRGELSQGMILAAAPSDDSELLLVNPGEMLTGSQVR
Download sequence
Identical sequences A0A0H2YVQ9
WP_011591157.1.50147 gi|110801166|ref|YP_697211.1| 195103.CPF_2847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]