SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801186|ref|YP_696943.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801186|ref|YP_696943.1|
Domain Number 1 Region: 88-286
Classification Level Classification E-value
Superfamily MetI-like 3.66e-26
Family MetI-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801186|ref|YP_696943.1|
Sequence length 304
Comment oligopeptide/dipeptide ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MQTELNKEVKVKKEKIESPWTVAFKRLKKNKLALGGLFILLVLVLISILGPMLYPHDHLT
IDLVRTNQPPSAQHWLGTDESGRDVLARLMYGGRYSLSIGIVAVGISIIIGTTLGILAGY
YGGFIDSLIMRIVDVFMCFPFLSLLIMVSAIMSDLKIPPEYRIFVVMFIIGALSWTGTCR
MVRGMVLSLREQEFMQAAEALGLSDARKMFLHLLPNTLAVIIVSATLGIGGAILTESSLS
FLGLGVTPPTPTWGNMIQTAQDYYTLTNRWWLWIPPGVCIFLTVISINIFGDGLRDALDP
KLKV
Download sequence
Identical sequences A0A0H2YUS2 A0A174FSS9 B1BMY0 B1BQS9 B1RA48 B1V395 Q0SQS5 Q8XI50
195102.CPE2271 195103.CPF_2553 289380.CPR_2256 gi|18311253|ref|NP_563187.1| WP_003454342.1.10161 WP_003454342.1.2058 WP_003454342.1.20964 WP_003454342.1.22226 WP_003454342.1.24595 WP_003454342.1.27537 WP_003454342.1.30163 WP_003454342.1.31832 WP_003454342.1.32463 WP_003454342.1.39851 WP_003454342.1.4402 WP_003454342.1.50147 WP_003454342.1.50713 WP_003454342.1.51349 WP_003454342.1.52260 WP_003454342.1.5234 WP_003454342.1.52659 WP_003454342.1.68380 WP_003454342.1.81392 WP_003454342.1.90682 WP_003454342.1.98368 gi|110801186|ref|YP_696943.1| gi|110803888|ref|YP_699532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]