SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801210|ref|YP_696599.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801210|ref|YP_696599.1|
Domain Number 1 Region: 7-193,345-576
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.56e-143
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000002
Further Details:      
 
Domain Number 2 Region: 578-830
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.36e-72
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000039
Further Details:      
 
Domain Number 3 Region: 195-345
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.49e-63
Family ValRS/IleRS/LeuRS editing domain 0.0000148
Further Details:      
 
Domain Number 4 Region: 815-879
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000000000126
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110801210|ref|YP_696599.1|
Sequence length 880
Comment valyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
Sequence
MDNKNISTTYNPKEFEERLYSNWQEKKYFTPVIDKSKKPYTIIMPPPNITGKLHLGHALD
NTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWE
WTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWC
PKCQTALSDAEIEYEEKEGNFWHIKYQVVGSEEFLEIATTRPETLLGDSAVAVNPSDERY
AHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMD
DSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISK
QWYVKMQSLADPAIEVVRNKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYC
KDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPT
STLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEV
IDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYK
DCKEYSLADKWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLY
GDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALN
NEKAEKDMTFIMEAIRSLRNLRAEMNVPPSRKAKVMAYASEEAKDAFINGGAYLEKLASA
SEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKK
LSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEALQ
Download sequence
Identical sequences A0A0H2YUQ4 A0A1U9VAD0
NYSGRC-FDAO-ABG84844 195103.CPF_2175 WP_011590997.1.10161 WP_011590997.1.2058 WP_011590997.1.50147 gi|110801210|ref|YP_696599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]