SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801226|ref|YP_694822.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801226|ref|YP_694822.1|
Domain Number 1 Region: 37-267
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000418
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 
Weak hits

Sequence:  gi|110801226|ref|YP_694822.1|
Domain Number - Region: 345-384
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0785
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110801226|ref|YP_694822.1|
Sequence length 597
Comment hypothetical protein CPF_0365 [Clostridium perfringens ATCC 13124]
Sequence
MKLKTHDDRLTLTNGSYHALVHARKPKGIENKSAYLIGTGIGALAAGCFLIRDAHMDGSK
ITFFEQLDLPGGSLDGEVLQNLGYVARGGREMGHHFEVLWGLFSSLPSTEDPNMTVLDHF
FYTNYDDPNYSNCRITHKNGERYDNAKFNLGQDLAKELAEFVLIPDEELQDKSIDEIFSE
ELLNTDFWTLWRTMFAFENWHSALEMKLYMNRFIHHVGGLPTLSALQFSRHDQYTSFVKP
MVKFLKENGARFEYGVHVENVEFDISDDKKVAKKIVAKDKNGKDISVNLTENDLVFITNG
SMTEGSGYGDDNTPAPFNKEPQGCWELWRNIAKQSDEFGHPDKFCTDTEKSNWESCTVTC
HDERVPKYIEKITKRSPYGGKTVTGGIVTAVDSSWLMSWTINRQEQYYGQPEKDVVVWVY
GLFSDVDGDYIKKPMRDCTGKEITKEWLFHIGVPVDEIEELAESCTAIPVMMPFITSQFM
PREFGDRPYVVPKNAVNFAFLGQFAETLDDPGRDTVFTIEYSGRTAMEAVYVLTGVEKGV
PEVYASRYDIRYLLNAGVCLLDGEKPKLDLPPLAKRKVMKQIAGTDIEKLLKEYGII
Download sequence
Identical sequences A0A0H2YUS6 A0A174EWH5 B1BNT1
195103.CPF_0365 gi|110801226|ref|YP_694822.1| WP_003461039.1.50147 WP_003461039.1.81392 WP_003461039.1.90682 WP_003461039.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]