SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801260|ref|YP_696173.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801260|ref|YP_696173.1|
Domain Number 1 Region: 53-236
Classification Level Classification E-value
Superfamily MetI-like 5.63e-21
Family MetI-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801260|ref|YP_696173.1|
Sequence length 251
Comment ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MKKFSYKNKKLIFLSSVILFILWQLASMIIGSEVILPSPYLTFKGLIEVIKSNDFFKIII
STLGRTFISFTLALVIALFLGVFSAFNKYVYNFMIPILNVMRSLPTIGFIILALIWLSQG
IAPILVGFVMSFPIFYDAIIGAILNIDKNILEMAKVYEIGMGNLIKNIYLPSISFAICRI
MVSTFSLTMKLVVGGEVIGQPKYGIGTALFVEKNYLNTNMVFAWIIVVIIIGIIFSLIQK
TIDGRVFRWMK
Download sequence
Identical sequences A0A0H2YVX3 A0A1U9V966 B1V0Y7 Q8XKB4
gi|110801260|ref|YP_696173.1| 195102.CPE1486 195103.CPF_1737 WP_003474008.1.100517 WP_003474008.1.10161 WP_003474008.1.2058 WP_003474008.1.20964 WP_003474008.1.30163 WP_003474008.1.31832 WP_003474008.1.32463 WP_003474008.1.43003 WP_003474008.1.4402 WP_003474008.1.50147 WP_003474008.1.50713 WP_003474008.1.52260 WP_003474008.1.5234 WP_003474008.1.52659 WP_003474008.1.68380 WP_003474008.1.98368 gi|18310468|ref|NP_562402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]