SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801278|ref|YP_696944.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801278|ref|YP_696944.1|
Domain Number 1 Region: 94-307
Classification Level Classification E-value
Superfamily MetI-like 3.92e-17
Family MetI-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801278|ref|YP_696944.1|
Sequence length 321
Comment oligopeptide/dipeptide ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MLQYITRRILLIIPTIVGVSLVLFFIFAMAPGDAITANMDPNMSVETKQAIREKYHLDEP
KTTQYMYWLKGVVTEGSLGESFYYKRPVSEVMKDFIPNSFILGAASLILGLIIAVPIGIV
SATKQYSFFDKFFTVFALMGISMPSFFFGLILIKYLGVQLNLFPISGMTTPGSAYTGMQY
VLDVLKHMILPLIVLTLGSVGGWMRYTRSSMLEVVRQDYIRTARAKGLKEKVVIYKHALR
NALIPVVTLLGMSIPGLFSGATLTEKIFNWPGIGPVQLSAVNNRDYYLLMGINLTLAILV
LIGNLLADIIYALVDPRIRLK
Download sequence
Identical sequences A0A0H2YVY7 A0A174FXF5 B1BMX9 B1BQT0 B1RA49 B1V394 Q8XI49
WP_003454494.1.10161 WP_003454494.1.2058 WP_003454494.1.20964 WP_003454494.1.23119 WP_003454494.1.24595 WP_003454494.1.27257 WP_003454494.1.27537 WP_003454494.1.30163 WP_003454494.1.31832 WP_003454494.1.32463 WP_003454494.1.39851 WP_003454494.1.43003 WP_003454494.1.4402 WP_003454494.1.50147 WP_003454494.1.50713 WP_003454494.1.51349 WP_003454494.1.52260 WP_003454494.1.5234 WP_003454494.1.52659 WP_003454494.1.5667 WP_003454494.1.68380 WP_003454494.1.81392 WP_003454494.1.90682 WP_003454494.1.98368 gi|18311254|ref|NP_563188.1| gi|110801278|ref|YP_696944.1| 195102.CPE2272 195103.CPF_2554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]