SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801319|ref|YP_697012.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801319|ref|YP_697012.1|
Domain Number 1 Region: 240-532
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.53e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 63-238
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.32e-62
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000219
Further Details:      
 
Domain Number 3 Region: 535-638
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.78e-32
Family Anticodon-binding domain of Class II aaRS 0.00014
Further Details:      
 
Domain Number 4 Region: 2-62
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000687
Family TGS domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801319|ref|YP_697012.1|
Sequence length 643
Comment threonyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
Sequence
MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEIC
TFDSKEGQHAFNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNKL
EEEMKKIIKENPEIKRFELPRNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCA
GPHLMAVKPIKAVKLLRSTGAYWKGDEKNKMLSRVYGTAFPKKSELDAYLEALEEAKKRD
HNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIEDEEQRRGYVLTKTPLMAKSD
LYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYRDLPVRFAETS
TLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITY
RFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVH
GKEDTIITIQIDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALP
TWIAPVQAKVLPLSDKYADYANEVVEELRRRGVRVEADHRAEKIGYKIREARLERTPYIL
VVGEKEAENKEVSVRSRKNGEEGAMPLADFVNRIVLEIANREN
Download sequence
Identical sequences A0A133MNI8 B1BQH9 B1R7R2 B1V446 Q0TMX8 Q8XI02
gi|18311304|ref|NP_563238.1| WP_003457830.1.100517 WP_003457830.1.10161 WP_003457830.1.2058 WP_003457830.1.20964 WP_003457830.1.22226 WP_003457830.1.23119 WP_003457830.1.27257 WP_003457830.1.27537 WP_003457830.1.30163 WP_003457830.1.32463 WP_003457830.1.35472 WP_003457830.1.39851 WP_003457830.1.43003 WP_003457830.1.50147 WP_003457830.1.50713 WP_003457830.1.51349 WP_003457830.1.52260 WP_003457830.1.5234 WP_003457830.1.52659 WP_003457830.1.5667 WP_003457830.1.68380 WP_003457830.1.81392 WP_003457830.1.90682 WP_003457830.1.98368 195102.CPE2322 195103.CPF_2631 gi|110801319|ref|YP_697012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]