SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801320|ref|YP_695643.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801320|ref|YP_695643.1|
Domain Number 1 Region: 4-194,346-400
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.94e-46
Family HI0933 N-terminal domain-like 0.0000514
Further Details:      
 
Domain Number 2 Region: 194-349
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 7.46e-39
Family HI0933 insert domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110801320|ref|YP_695643.1|
Sequence length 403
Comment pyridine nucleotide-disulfide oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MSNKKVIVVGGGPAGIMASLTASANNEVVLIERNNEIGKKLRLTGGGRCNITNNREIEEF
FDKIVTNNKFMYSALYTFSNYQLLDFLSKKGLEYKVELDQKVYTKSDTAEEVISIFKNEL
NDCRVKVLYNTKVCDFIVEEDEIKGIITEQGKKILGDKIIITTGGKSFPNTGSDGEMYGI
LEKYGHTITPIHAALIPLVTKEDFVKNLQGVAMKDVVVSAKIKKKKYEKFGDMIFTHFGV
SGPAILKLSSYITKALDQGEVELSLDFLSDKSKEELSQIIRSNPNKTVLNNLKGTLPQNF
LKQIFEMLGLTEIKASDLKKEDENKIISYIKEMKLTVRETLTIKAAQVTSGGVKVKEINA
STMESKIIKNLYFAGEVIDIDAETGGYNLQMAFSTGYLAGSDF
Download sequence
Identical sequences A0A0H2YV42 B1R5I4
195103.CPF_1197 WP_003456357.1.20964 WP_003456357.1.27537 WP_003456357.1.30163 WP_003456357.1.39851 WP_003456357.1.50147 WP_003456357.1.52260 WP_003456357.1.5234 WP_003456357.1.52659 WP_003456357.1.68380 gi|110801320|ref|YP_695643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]