SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801346|ref|YP_696761.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801346|ref|YP_696761.1|
Domain Number 1 Region: 30-317
Classification Level Classification E-value
Superfamily MetI-like 2.33e-53
Family MetI-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110801346|ref|YP_696761.1|
Sequence length 318
Comment ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MLETIKQKRLQKKAEPKEEVNKFNAVSKKSNFLLNVLFAILAFLAIMPFVFVIAISLTNE
QSLQLNGYRFIPEEWSLEAYKYIFSSGSQILTSYGVTITVTIVGTLIGLAIMSMYGYALS
RKSFAYRKFFTKVIFVPMLFSGGMVASYLVVTRFLGLKNTIWALILPMCVSSFHIIILRT
FFKTSVPDAIIESAKIDGASEWRLFLRIVLPISLPGIATIGLFLTLGYWNDWFNAMLYID
EPNLIPLQYLLIRLENSMEFLANNATSLGANAIEATKSMPKDTAKMAIVVISTLPIIFAY
PFFQRYFVNGLTIGAVKE
Download sequence
Identical sequences A0A0H2YV12 A0A173X3Y8 B1BID5 B1BSS2 B1R3G4 Q8XIN4
gi|18311063|ref|NP_562997.1| 195102.CPE2081 195103.CPF_2338 gi|110801346|ref|YP_696761.1| WP_003451608.1.100517 WP_003451608.1.10161 WP_003451608.1.2058 WP_003451608.1.20964 WP_003451608.1.22226 WP_003451608.1.23119 WP_003451608.1.24595 WP_003451608.1.27257 WP_003451608.1.27537 WP_003451608.1.30163 WP_003451608.1.32463 WP_003451608.1.43003 WP_003451608.1.50147 WP_003451608.1.51349 WP_003451608.1.52260 WP_003451608.1.5234 WP_003451608.1.52659 WP_003451608.1.5667 WP_003451608.1.68380 WP_003451608.1.81392 WP_003451608.1.90682 WP_003451608.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]