SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801347|ref|YP_696443.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801347|ref|YP_696443.1|
Domain Number 1 Region: 405-569
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.71e-46
Family Histidine kinase 0.00047
Further Details:      
 
Domain Number 2 Region: 335-414
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.65e-20
Family Homodimeric domain of signal transducing histidine kinase 0.00052
Further Details:      
 
Domain Number 3 Region: 182-230
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000314
Family HAMP domain 0.0049
Further Details:      
 
Domain Number 4 Region: 231-342
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000704
Family Heme-binding PAS domain 0.034
Further Details:      
 
Weak hits

Sequence:  gi|110801347|ref|YP_696443.1|
Domain Number - Region: 40-113
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0722
Family Sensory domain of two-component sensor kinase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801347|ref|YP_696443.1|
Sequence length 571
Comment sensory box histidine kinase [Clostridium perfringens ATCC 13124]
Sequence
MKKRIIIFTTLIITFFLAIMTSMYLVISNHKYLEESKNVLNEYNKVIALLLENDNGNIKS
ELERIESNNDMKNIRITYISKDGNVIFDTHKKLINDNESYLKRQEIIEAIESGLGSSVRY
SNDLHQNMIYSALKLKDGSIVRTSIAVENAKILDSINSNYLLVGVILSLVIALLLTVKIT
NIILNPLKELEQLTSTIASGNFHKRVKINSKDDEIQRLGKSFNYMAEQLEITMERFKDKQ
NGLEAILKSMGSGVIAFDRDMNVLMINPYAKKIFGISGEIIGNKLLDYITDKEVLKAFFD
EKDRVEIEVNYNDDPKILKIRKASIINEPEIIGTVVVIQDITDIKKLENMRSQFVANISH
ELKTPLTSIKGFAETLRYVDDDETRNKFLSIIDEESDRLARLLEDILCLYEIEQKRSTVL
EEFNVDEEIEKVYMLLNDQAKKKGVEIFLDTNSNCVLMGDKDKFKQMLLNLVSNSVKYTE
KGGKVRVESYNRDMNLVLVIEDNGIGISAEDLPRIFERFYRVDKARSRESGGTGLGLAIV
KHIVRLFDGEINVTSELGVGTKIVITIPINI
Download sequence
Identical sequences A0A0H2YW48 A0A1U9V9L5 B1BWA3 B1R8E0 B1V4A5
195103.CPF_2010 IDP04258 NYSGRC-FDAO-ABG84981 gi|110801347|ref|YP_696443.1| WP_003458438.1.10161 WP_003458438.1.2058 WP_003458438.1.20964 WP_003458438.1.22226 WP_003458438.1.27257 WP_003458438.1.27537 WP_003458438.1.30163 WP_003458438.1.50147 WP_003458438.1.50713 WP_003458438.1.52260 WP_003458438.1.5234 WP_003458438.1.52659 WP_003458438.1.68380 WP_003458438.1.90682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]