SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801357|ref|YP_695925.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801357|ref|YP_695925.1|
Domain Number 1 Region: 1-304
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.71e-46
Family FMN-linked oxidoreductases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801357|ref|YP_695925.1|
Sequence length 321
Comment dihydrouridine synthase [Clostridium perfringens ATCC 13124]
Sequence
MKYYLAPMEGITGFIYRNSYEKFFGGIDKYFAPFVVPNSSKSLKTKELRDVLPENNKGIN
LVPQILTNDSEGFISTARKLKQLGYNEINLNLGCPSGTVVGKKRGSGFLAHKEELDKFLE
EIFKIDDMKLSIKTRLGMDKPEEFYELIKIYNKYPMEELIIHPRTRQDFYANKPNLEVFK
DAISLSKNPICYNGDIFTVEDHNKLIETFPEVDKIMLGRGILANPALMNEILNNEFMDKK
VLKEFHDEVFNKYREVFNEDRNAMFRMKELWGYMIYMFSNNKKYAKKIKKAQKVVEYNQA
VTSLFLEQDILKGAGLFSSEE
Download sequence
Identical sequences A0A0H2YV21
WP_011590729.1.50147 gi|110801357|ref|YP_695925.1| 195103.CPF_1482 NYSGXRC-11106h

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]