SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801370|ref|YP_696383.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801370|ref|YP_696383.1|
Domain Number 1 Region: 21-246
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 1.19e-94
Family Undecaprenyl diphosphate synthase 0.000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801370|ref|YP_696383.1|
Sequence length 253
Comment undecaprenyl pyrophosphate synthase [Clostridium perfringens ATCC 13124]
Sequence
MLDFFSKKGNEDSEEIVLIEDKMPKHIAIIMDGNGRWAKKRGLPRTMGHRAGVKTIKTIV
KECDKLGVKYLTLYAFSTENWKRPEDEVNALMKLVVEFIKNEIDELHQNGVRVQTIGDLS
RFPEEPKKAILWAMEKTKDNTGVVLSLALNYGGRNEIVRGIKSVIEDVKAGKISIDDINE
DMFNDYLYTKGMPDPDLIIRPSGEQRLSNFLLWQCAYSEFWYSQINWPDFNGEDLRKAIF
DYQNRDRRFGGIK
Download sequence
Identical sequences A0A0H2YV56 A0A133NE96 B1BG15 B1BYE1 B1RAG6 B1V7R8 Q0SSC4 Q8XJQ9
195102.CPE1696 195103.CPF_1950 289380.CPR_1668 gi|18310678|ref|NP_562612.1| gi|110803535|ref|YP_698983.1| WP_003459793.1.100517 WP_003459793.1.10161 WP_003459793.1.2058 WP_003459793.1.20964 WP_003459793.1.22226 WP_003459793.1.23119 WP_003459793.1.24595 WP_003459793.1.27257 WP_003459793.1.27537 WP_003459793.1.30163 WP_003459793.1.32463 WP_003459793.1.35472 WP_003459793.1.39851 WP_003459793.1.43003 WP_003459793.1.50147 WP_003459793.1.50713 WP_003459793.1.51349 WP_003459793.1.52260 WP_003459793.1.5234 WP_003459793.1.52659 WP_003459793.1.5667 WP_003459793.1.68380 WP_003459793.1.81392 WP_003459793.1.90682 WP_003459793.1.98368 gi|110801370|ref|YP_696383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]