SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801396|ref|YP_697119.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801396|ref|YP_697119.1|
Domain Number 1 Region: 175-301
Classification Level Classification E-value
Superfamily PIN domain-like 3.49e-24
Family PIN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801396|ref|YP_697119.1|
Sequence length 368
Comment PIN/TRAM domain-containing protein [Clostridium perfringens ATCC 13124]
Sequence
MIKKIFRVIFTILGLLIGFVLADGIRKSAIGNEYLTNIFFKVSFYVILIAVFGIILFILS
PFIYKSIRKLITFIEKGISKLSPSEIIFGAGGAIVALVLALVITLPLSSFLSGLNEMLGP
IVSVIINIIAMIIGADIAVKKREDITGYFENFRKNQSKEKKTKNSSNKKNEATPKVLDTS
VIIDGRIFDLCQTGFIEGALVIPTFVLDELRHISDCSDSLKRTRGRRGLDILNKIQKELP
IEVIMWEGDFPEIAEVDIKLLKLAQKLNGKVVTNDYNLNKVAEFQGVPVLNINELANAIK
PVVLPGEEMTLTVVKDGKESGQGVAYLDDGTMIVVEGGRKYMGKEITVVVTSVLQTAAGR
MIFAKYKS
Download sequence
Identical sequences A0A0H2YV63 A0A174HTI7 B1RA09
195103.CPF_2740 WP_003459365.1.20964 WP_003459365.1.22226 WP_003459365.1.27537 WP_003459365.1.30163 WP_003459365.1.31832 WP_003459365.1.43003 WP_003459365.1.4402 WP_003459365.1.50147 WP_003459365.1.52260 WP_003459365.1.5234 WP_003459365.1.52659 WP_003459365.1.5667 WP_003459365.1.68380 WP_003459365.1.81392 gi|110801396|ref|YP_697119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]