SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801423|ref|YP_695072.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801423|ref|YP_695072.1|
Domain Number 1 Region: 23-289
Classification Level Classification E-value
Superfamily MetI-like 2.09e-38
Family MetI-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110801423|ref|YP_695072.1|
Sequence length 295
Comment phosphate ABC transporter permease [Clostridium perfringens ATCC 13124]
Sequence
MEAKSQNNKSKYFIESLTEKIFLISASVAVISLLLIIGFVFYKGLRPFIIEGYSFWDFIF
GTQWIPSANKYGILPMIVASLGATIGALLIGVPVGILTSIFIAEIAPKKIAKIMSGAVEL
LAGIPSVLYGVFGLAIIVPTIQEVFNLPKGQSLLAVIIVLAIMMLPTVITVSETAIRAVP
NAYKEGSLALGASKTETIFKVIVPAAKSGIMTGVVLGIGRAIGETMAVILVAGNTPVIPS
SIMDSVRPLTTNIALEMGYAFGTHQEMLFATGVVLFTFILILNLVLSKLSNKGGK
Download sequence
Identical sequences A0A0H2YWB2 A0A174DPR5 B1BLQ6 B1RBU4
WP_003453504.1.10161 WP_003453504.1.2058 WP_003453504.1.20964 WP_003453504.1.23119 WP_003453504.1.24595 WP_003453504.1.27537 WP_003453504.1.30163 WP_003453504.1.35472 WP_003453504.1.50147 WP_003453504.1.52260 WP_003453504.1.5234 WP_003453504.1.52659 WP_003453504.1.68380 WP_003453504.1.81392 WP_003453504.1.98368 gi|110801423|ref|YP_695072.1| 195103.CPF_0619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]