SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801428|ref|YP_697345.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801428|ref|YP_697345.1|
Domain Number 1 Region: 7-67,98-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.87e-41
Family GidA-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110801428|ref|YP_697345.1|
Sequence length 630
Comment tRNA uridine 5-carboxymethylaminomethyl modification protein GidA [Clostridium perfringens ATCC 13124]
Sequence
MRYNAGSYDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMPCNPNIGGTAKGHL
VREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQERMKKVLETQENLH
LRQLEVVSVEVEDGKVKGVLTKNGAFFECKAVIMTSGTYLQSRIIIGDVSYSQGPNGLSN
ANELSKSLIDLGIDLRRFKTGTPARINKRSVDFSKMIEQPGDEEIIPFSFISGNIDRDQV
SCWLTYTNEETHKVIQENIHRSPMYNGSIKGVGPRYCPSIEDKVMRFQDKDRHQIFIEPE
GDDTEEMYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIEYDCIDPTQLKASLEFK
NIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKDPMILTRSDGYVGVLIDDLITK
GTNEPYRMMTSRAEYRLLLRQDNADFRLTEIGHNVGLVTEERWSKFQERKQNLERELERL
KELQITNKTENNEKIVELGSTELKKPIRMYELIKRPELDYFSLACLDPERPDLPKDIGDQ
INIIARYEGYIQTQLEQVAQFKKFEKKVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQA
SRISGVSPADISVLLIFLEHYRKTGKNTDN
Download sequence
Identical sequences B1BI65 B1RAU7 Q0TLZ5
195103.CPF_2991 WP_003451018.1.20964 WP_003451018.1.23119 WP_003451018.1.24595 WP_003451018.1.27537 WP_003451018.1.30163 WP_003451018.1.50147 WP_003451018.1.52260 WP_003451018.1.5234 WP_003451018.1.52659 WP_003451018.1.68380 gi|110801428|ref|YP_697345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]