SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261876163|ref|YP_694766.2| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261876163|ref|YP_694766.2|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.55e-22
Family GntR-like transcriptional regulators 0.015
Further Details:      
 
Domain Number 2 Region: 97-226
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.45e-19
Family GntR ligand-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261876163|ref|YP_694766.2|
Sequence length 228
Comment FCD domain-containing protein [Clostridium perfringens ATCC 13124]
Sequence
MFKPVKNMKVYEQVVDQIKEMVRVGQIKKGDKLPTERVMAEELQVSRTSIREAMRALEVV
GLIESRQGAGNYIREEFDDVLLEPLSIVFMLQNGTNKDIFELREVLELSTIFLSVMRISD
EELKKLGELVERFKTSRDEEENVKIDSEFHSIIVKGANNVLITNLLEGVSELVDKFISEG
RRAILSDERNRGKLLDFHEKIYLAIKNRDAYSAYKHMQEHFQLIKENI
Download sequence
Identical sequences A0A0H2YRP6 A0A174EPC5 B1BWN2 B1R7Z6 B1V0J5 Q8XNM4
gi|261876163|ref|YP_694766.2| gi|18309291|ref|NP_561225.1| 195102.CPE0309 195103.CPF_0306 WP_003458079.1.100517 WP_003458079.1.20964 WP_003458079.1.22226 WP_003458079.1.23119 WP_003458079.1.27257 WP_003458079.1.27537 WP_003458079.1.30163 WP_003458079.1.32463 WP_003458079.1.39851 WP_003458079.1.43003 WP_003458079.1.50147 WP_003458079.1.50713 WP_003458079.1.51349 WP_003458079.1.52260 WP_003458079.1.5234 WP_003458079.1.52659 WP_003458079.1.5667 WP_003458079.1.68380 WP_003458079.1.81392 WP_003458079.1.90682 WP_003458079.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]