SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110798735|ref|YP_695723.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798735|ref|YP_695723.1|
Domain Number 1 Region: 120-272
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.7e-51
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0001
Further Details:      
 
Domain Number 2 Region: 2-118
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 1.83e-33
Family DHN aldolase/epimerase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110798735|ref|YP_695723.1|
Sequence length 273
Comment dihydroneopterin aldolase/ 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Clostridium perfringens ATCC 13124]
Sequence
MDKIIIKDFEVFGNHGVFEEEKRLGQKFVLSIELFLDTREAGVTGDLSKSVHYGELAHKV
EEEFKKQSYDLIETAAEKLCEFILLEYPLVKKVKVSLKKPWAPILRSLDTVSIEIERGWN
EAYLSYGSNIGDKKYYIEEALNEINKAYHTEIIKKSNLIETEPWGYTEQDEFLNGACKIK
TLLNPKELIKFLLSVEQKLKRERKIKWGPRTIDLDVIFFNDLISEDEEIILPHPRMHERS
FVLEPLNEIAPYKIHPLYRKRVFELLEELNKNK
Download sequence
Identical sequences A0A0H2YPG3 A0A1U9V7E7
195103.CPF_1277 WP_011590646.1.10161 WP_011590646.1.2058 WP_011590646.1.50147 WP_011590646.1.51349 gi|110798735|ref|YP_695723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]