SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110798964|ref|YP_696613.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110798964|ref|YP_696613.1|
Domain Number 1 Region: 3-312
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000256
Further Details:      
 
Domain Number 2 Region: 324-406
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.91e-24
Family Anticodon-binding domain of Class II aaRS 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110798964|ref|YP_696613.1|
Sequence length 415
Comment histidyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
Sequence
MAIQAQKGTKDMLPNDAYKWHYIEEKLRKISAEYGIREIRTPMFEATELFKRGVGETTDV
VQKEMYTFEDKGGRSITLKPEGTAPAVRAFIENSLYADAQPTKMFYFTPCFRYEKMQKGR
LREFHQYGIEVFGSQEASIDAEILSLVMRALTEDFGIKGLSLNINSLGCPKCRAKFNEAL
KQYLKENYDNLCETCKTRFEKNPMRIIDCKEKRCKEIVKEAPSILDYICEECSDHFSKLK
AYLDVMGIEYNIDPQIVRGLDYYSKTVFEVIKDGLTVCGGGRYDYLVEEVDGPKTPAMGF
GLGLERLLLILDEEGIEIPEPVRCEVYIGSMGDNAKLEAMKLAFNLRKAGIKAEIDHLGK
SVKAQMKYANKIGAKYTFVIGDSEIEENKIKIKRMSDGEQFEVSLDINEIVNIVK
Download sequence
Identical sequences A0A1U9V9Y8 Q0TP27
195103.CPF_2189 gi|110798964|ref|YP_696613.1| WP_003478447.1.10161 WP_003478447.1.2058 WP_003478447.1.50147 WP_003478447.1.5667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]