SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799800|ref|YP_696714.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799800|ref|YP_696714.1|
Domain Number 1 Region: 63-151
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 1.31e-25
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.00096
Further Details:      
 
Domain Number 2 Region: 161-208
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.00000000000000144
Family Head domain of nucleotide exchange factor GrpE 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110799800|ref|YP_696714.1|
Sequence length 208
Comment heat shock protein GrpE [Clostridium perfringens ATCC 13124]
Sequence
MVDNKDFNEELKENIQEELDNETKAENPNIDEEVEEVSEDIKADEKVIDFEELKALKEEN
TMFKSKTKKLENELEALKDRLLRISAEYENYRKRTDKEKERIYTDACEDVLIKMLPVLDN
LERALAVDGTVEDLKKGVEMTVRQFEDALEKLQVEEISTENGFDPELHQAMMVVEQEGAE
PNQVAQVFQKGYKRGDKVIRHSMVTVTK
Download sequence
Identical sequences A0A173XBG4 B1BPJ5 Q0TNS6
WP_003461874.1.10161 WP_003461874.1.2058 WP_003461874.1.20964 WP_003461874.1.22226 WP_003461874.1.23119 WP_003461874.1.31832 WP_003461874.1.4402 WP_003461874.1.50147 WP_003461874.1.51349 WP_003461874.1.52260 WP_003461874.1.5234 WP_003461874.1.52659 WP_003461874.1.5667 WP_003461874.1.68380 WP_003461874.1.81392 WP_003461874.1.90682 WP_003461874.1.98368 gi|110799800|ref|YP_696714.1| 195103.CPF_2291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]