SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799853|ref|YP_696574.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799853|ref|YP_696574.1|
Domain Number 1 Region: 85-172
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.03e-31
Family Translation initiation factor IF3, C-terminal domain 0.0000876
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 6.02e-30
Family Translation initiation factor IF3, N-terminal domain 0.0000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110799853|ref|YP_696574.1|
Sequence length 173
Comment translation initiation factor IF-3 [Clostridium perfringens ATCC 13124]
Sequence
MNKISKNFAINQEIREKEVRLISSTGEQLGVVSGRDAQKMADEAELDLVMISPNAKPPVC
KIMDYGKFIYEQSKKEKEAKKKQKVISVKEIRVSPTIEKHDLEIKAKNAKKFLEAGDKVK
ITVRFRGREAEHSHVGVKILDSFLAQLEEVCSVEKPAKLEGRNMIMILAPKKA
Download sequence
Identical sequences A0A0H2YSQ2 A0A127EKC9
gi|110799853|ref|YP_696574.1| 195103.CPF_2146 WP_011590984.1.100517 WP_011590984.1.10161 WP_011590984.1.1075 WP_011590984.1.13323 WP_011590984.1.1394 WP_011590984.1.14338 WP_011590984.1.17789 WP_011590984.1.2058 WP_011590984.1.27360 WP_011590984.1.28470 WP_011590984.1.28529 WP_011590984.1.29129 WP_011590984.1.29428 WP_011590984.1.3228 WP_011590984.1.4345 WP_011590984.1.44743 WP_011590984.1.48074 WP_011590984.1.4818 WP_011590984.1.50147 WP_011590984.1.64066 WP_011590984.1.66593 WP_011590984.1.67534 WP_011590984.1.76352 WP_011590984.1.78174 WP_011590984.1.83225 WP_011590984.1.85755 WP_011590984.1.87374 WP_011590984.1.93653 WP_011590984.1.96543 WP_011590984.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]