SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110799889|ref|YP_694944.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110799889|ref|YP_694944.1|
Domain Number 1 Region: 1218-1414
Classification Level Classification E-value
Superfamily Cell wall binding repeat 1.85e-42
Family Cell wall binding repeat 0.0000551
Further Details:      
 
Domain Number 2 Region: 621-842
Classification Level Classification E-value
Superfamily Cell wall binding repeat 2.35e-39
Family Cell wall binding repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 824-1053
Classification Level Classification E-value
Superfamily Cell wall binding repeat 1.28e-37
Family Cell wall binding repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 972-1207
Classification Level Classification E-value
Superfamily Cell wall binding repeat 2.07e-35
Family Cell wall binding repeat 0.0000688
Further Details:      
 
Domain Number 5 Region: 246-291,318-395,449-476,503-527,574-636
Classification Level Classification E-value
Superfamily Cell wall binding repeat 2.09e-33
Family Cell wall binding repeat 0.00071
Further Details:      
 
Domain Number 6 Region: 1400-1555
Classification Level Classification E-value
Superfamily Cell wall binding repeat 2.85e-22
Family Cell wall binding repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 418-501
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.000000000902
Family Cell wall binding repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110799889|ref|YP_694944.1|
Sequence length 1557
Comment cell wall binding repeat-containing protein [Clostridium perfringens ATCC 13124]
Sequence
MKKVREKVAIAVAIASITTISSFVISNGKKVYAEEVRVTATANVDNIKDNGKQLKNESPK
ANTQEDTNVKNKDLKTDEKKDIKEVESNFVKNAENKTEKINEDKSLENNNNKVSTKLESS
DKDVKEIKSDKDSKDKDSKEVKDENVEKVHNKKDTVEEVENKSDQNNEDKINTDKKVEVK
SKDNETSKRDEESKKIKGENKESESKLDKNKALKSDYININESGQALTVGTESQNNSVTD
ENEKDGWQTIGGKTYYFENGKVSTGKKEVYDTKNGYYKTYFFNEDGTLVTDTGIHDYCES
WGGKRKVYVNNKGEVENGWKTIDGKTYYFDQYNGMLTNVHEIDNGDKKEAYLFDNDGVLR
KGTGLKEIDGKWYYFNKDNSLASGWKTIDGKTYYFDTYSGRAKGSIRIYDSNHEKYKVYL
FNEDGALITEPGIHTYHENWGGERKIYVNNKGEVQSGWQIIDGKTYYFDESNGMVTWVHE
INENDKNKSYLFDKDGVLVKGSGWKEINGNWYYLNNDNSLLEGWKTIDDRTYYLDKYNGM
VNGVYEVNSGDKKETYLFNKDGSLVKGNGLKEVNGTWYYFNSDNSLENGWKIIDGKTYYF
NKYDGRLRGCVRVYDDLNHEKYKVYFFNEDGVLITEPGIHTYHETWGGERKICINNKGEV
QSGWQIIDGKTYYFDEHNGMAKGVSCISNGDNYEVYLFNEDGSLVTGNGWKEIDGKWYYF
NNNNSLANGWKTINGKTYYFSSHMSIGPTLIQGNRPEKLDLYYFGEDGELINRKGWAKLN
DDWFYFNDDSSLKTKWQTIGGKTYYFNETTGAMATGQKTTYDYFNHEEKIYCFTSDGSLL
KGKGWFSKYDEYNNYKKVWFYIDEDGVLKTDYQTINGKDYYFYCDGKMATGIVNVEGVTG
NPKFYYFDNNGDLFKKEGWKKINEKWYYLNEDGSLVNEWKKSGSDWYYLNPNYGMAIGPT
KVQDDMCLGINVYYFEEDGRLTNRTGWINHINGEFSDWYYVENGGKAALGWNKINGTWYY
FNSDAKMVTAPTRIFDKDSSKEKIYFFDKNGAYRRYSGWYELKPVDGEPCWYYFGEDGLA
KTGWQTINGNKYWFAPNGIMCKGTSTIFENEVEDGCYKVDLPTYLFNESGALVTSEGWHK
VTLYDGEKWCYTDNTGLCKKRLEKINNKYYYFEPHNGLMETGVISIYGFNGNKEANYFFD
ESGALNTSKGWHKCKDRYNSHYIWCYIDDNGELAEGFKEINGNKYYFESGVMSTGKTEIE
GNQYYFNESGLIAKGWSQNKDGEYYYTDNNGIIQKGWQKINGIWYYFNDGGVMATGPKYM
FDENTYDTKLYYFDNSGALQYKKGWVNHIGKYNNDWYYINSNNELSTGWQNINGTWYYFY
ENGKMAKGSTAVTYSNGDKRYYCFDNSGAWVTNPGWHSWQDEGNKTCWAYINNDGSLAEG
WKEINNKWYYFYKENKVMAKGAIKEWDYKTNKPYIQHFFNEDGSWDASEGWKSFKNLEYS
PDLQWAYVESNGRLASGWKMIGGQWYYFDEGNGFMVTEKRYIDGKFYEFNSNGTLKN
Download sequence
Identical sequences A0A0H2YRB4
NYSGRC-SEC-110799889 195103.CPF_0490 gi|110799889|ref|YP_694944.1| WP_011590223.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]