SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800365|ref|YP_696925.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800365|ref|YP_696925.1|
Domain Number 1 Region: 1-200
Classification Level Classification E-value
Superfamily ITPase-like 3.4e-68
Family ITPase (Ham1) 0.0000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800365|ref|YP_696925.1|
Sequence length 204
Comment deoxyribonucleotide triphosphate pyrophosphatase [Clostridium perfringens ATCC 13124]
Sequence
MKKFILASNNAHKVKEIKEILKDFNLNILSLNEAGIDIDVEEDGKTFEENSFKKANEIRK
YLLSKGESDFIVMADDSGLEVDYLNGAPGIYSARYAGEHGNDSKNNEKLLEELKNVKEDE
RKANFICVIVAVTDKGEKIVAEGKSYGVILEALSGNEGFGYDPLFFVPEYKKTFAEMTSD
EKNAISHRGRALEKLKDNLKGILK
Download sequence
Identical sequences A0A0H2YSI3
195103.CPF_2535 gi|110800365|ref|YP_696925.1| WP_003482252.1.22226 WP_003482252.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]