SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800513|ref|YP_695178.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800513|ref|YP_695178.1|
Domain Number 1 Region: 11-225
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.2e-58
Family N-type ATP pyrophosphatases 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800513|ref|YP_695178.1|
Sequence length 227
Comment hypothetical protein CPF_0726 [Clostridium perfringens ATCC 13124]
Sequence
MKKWSNGAKGKKFIASYSGGKDSTLALYKAMQEGKAIGIIVMMEEDGERSRAHSLFPSVL
KAQAEAIGLPLFTAVTNWDDYEKVFVKKLKEAKDLGAEVLVTGDIDVPEEECWHERVTNS
IGLGLGMPLWRKNHKEVVEEFVNLGFVTKIVTVNLNKGMKKEDLGRILTFDYIKELEERG
IDPCGEAGEFHSTVIGGPLFKKELRVKHGEIISEGNYMYLTLELENL
Download sequence
Identical sequences A0A0H2YT15
WP_011590334.1.23119 WP_011590334.1.50147 gi|110800513|ref|YP_695178.1| 195103.CPF_0726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]