SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800610|ref|YP_694869.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800610|ref|YP_694869.1|
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-24
Family HI0933 N-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110800610|ref|YP_694869.1|
Sequence length 296
Comment oxidoreductase [Clostridium perfringens ATCC 13124]
Sequence
MREYDLIIIGGGASGLLLAINGKKDGIKNILLVEKDPILGGALNSADYNISEKGNLTGIE
YKESLLKEFNELNIDVKLNTMVLKIEDSNEILCTSSEYGVEKIKGKNIIITNGGKEKSRN
AVQIPGDRTAGVLTVGMAKKIFGIKNMVPGKNIFIVGDSTLYMIQEDLKKHNIKVSGIIT
DKNKNEVFDLSENLYPGYEIVSIHGEGRVSSVTIKNDDEKKNIKCDTVIFAYPMISDGLV
ALRSGLKLNPSTTGPAVDENLETSSKNIYACGNAIYIHKSIEEIEDECKKLIKTIS
Download sequence
Identical sequences A0A0H2YT72 B1BNP9
WP_003461122.1.27257 WP_003461122.1.50147 WP_003461122.1.51349 WP_003461122.1.90682 gi|110800610|ref|YP_694869.1| 195103.CPF_0412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]