SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110800944|ref|YP_695745.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110800944|ref|YP_695745.1|
Domain Number 1 Region: 1-216
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.19e-63
Family N-type ATP pyrophosphatases 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110800944|ref|YP_695745.1|
Sequence length 217
Comment hypothetical protein CPF_1299 [Clostridium perfringens ATCC 13124]
Sequence
MKKKFVVSYSCGKDSTLSLYRMIKAGHTPVALLVTVDKKVLRSWFHGIPDKLLKDVSKSL
DIPLVLVASNGKENYGETFVEALKKIKEEMGAEACVFGDIDLMAHRTWCEDKCEKAGLEA
IFPLWEEDREALTYEFIDSGFKTVIKNVKLSILGEEFLGEVLTKDVVERLKAAGSDACGE
NGEYHTFVFDGPLFKERINFETGDNILTETHGFLDIK
Download sequence
Identical sequences A0A0H2YUR5 A0A174BDL0 B1BU63 B1R8R2 B1V581 Q0STW7 Q8XLJ7
WP_003458530.1.100517 WP_003458530.1.20964 WP_003458530.1.22226 WP_003458530.1.23119 WP_003458530.1.27257 WP_003458530.1.27537 WP_003458530.1.30163 WP_003458530.1.31832 WP_003458530.1.32463 WP_003458530.1.35472 WP_003458530.1.39851 WP_003458530.1.43003 WP_003458530.1.4402 WP_003458530.1.50147 WP_003458530.1.50713 WP_003458530.1.51349 WP_003458530.1.52260 WP_003458530.1.5234 WP_003458530.1.52659 WP_003458530.1.5667 WP_003458530.1.68380 WP_003458530.1.81392 WP_003458530.1.90682 WP_003458530.1.98368 gi|18310026|ref|NP_561960.1| gi|110803898|ref|YP_698440.1| gi|110800944|ref|YP_695745.1| 195102.CPE1044 195103.CPF_1299 289380.CPR_1118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]