SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801369|ref|YP_696982.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801369|ref|YP_696982.1|
Domain Number 1 Region: 91-152
Classification Level Classification E-value
Superfamily Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain 0.00000000000000785
Family Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain 0.0053
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000816
Family mannose-1-phosphate guanylyl transferase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110801369|ref|YP_696982.1|
Sequence length 162
Comment mannose-6-phosphate isomerase, partial [Clostridium perfringens ATCC 13124]
Sequence
MHCTFIKSTDVILREIEKYIPKMYKCLMEIYQHIGEDDEEEIIKEQYSLIDGISIDFGVM
QKTRRSFVIKCDFSWDDIGTFSALSRFLGPNGNNRTSDNVFLEECENCSVFGKEKLIIGF
GIKDLVLVDAGDVILVMDKGRDQEIKHLLNSISGKKEFKEYL
Download sequence
Identical sequences A0A0H2YW65
195103.CPF_2592 gi|110801369|ref|YP_696982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]