SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110801393|ref|YP_696730.1| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110801393|ref|YP_696730.1|
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.24e-30
Family Anti-sigma factor antagonist SpoIIaa 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110801393|ref|YP_696730.1|
Sequence length 111
Comment anti-sigma F factor antagonist [Clostridium perfringens ATCC 13124]
Sequence
MWLDFEKIGNVLVVSLIGELDHHSAEEVRVKIDDRISRENIRKLVLDFSGVTFMDSSGIG
VIIGRYKKISMRSGEVNIISVSKSIKRVFELSGIFKIIKYYENLDEALKVG
Download sequence
Identical sequences A0A0H2YV80 A0A133N593 B1BIG7 B1BSP2 B1R3D3 B1UZ54 Q0SRC6 Q8XIR4
gi|18311032|ref|NP_562966.1| gi|110801809|ref|YP_699331.1| gi|110801393|ref|YP_696730.1| 195102.CPE2050 195103.CPF_2307 289380.CPR_2022 IDP04053 WP_003451156.1.100517 WP_003451156.1.10161 WP_003451156.1.1075 WP_003451156.1.13323 WP_003451156.1.1394 WP_003451156.1.14338 WP_003451156.1.17789 WP_003451156.1.2058 WP_003451156.1.20964 WP_003451156.1.22226 WP_003451156.1.23119 WP_003451156.1.24595 WP_003451156.1.27257 WP_003451156.1.27360 WP_003451156.1.27537 WP_003451156.1.28470 WP_003451156.1.28529 WP_003451156.1.29129 WP_003451156.1.29428 WP_003451156.1.30163 WP_003451156.1.31832 WP_003451156.1.3228 WP_003451156.1.32463 WP_003451156.1.35472 WP_003451156.1.39851 WP_003451156.1.43003 WP_003451156.1.4345 WP_003451156.1.4402 WP_003451156.1.44743 WP_003451156.1.48074 WP_003451156.1.4818 WP_003451156.1.50147 WP_003451156.1.50713 WP_003451156.1.51349 WP_003451156.1.52260 WP_003451156.1.5234 WP_003451156.1.52659 WP_003451156.1.5667 WP_003451156.1.64066 WP_003451156.1.66593 WP_003451156.1.67534 WP_003451156.1.68380 WP_003451156.1.76352 WP_003451156.1.78174 WP_003451156.1.81392 WP_003451156.1.83225 WP_003451156.1.85755 WP_003451156.1.87374 WP_003451156.1.90682 WP_003451156.1.93653 WP_003451156.1.96543 WP_003451156.1.98368 WP_003451156.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]