SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261876168|ref|YP_697160.2| from Clostridium perfringens ATCC 13124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261876168|ref|YP_697160.2|
Domain Number 1 Region: 8-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.98e-57
Family PP-loop ATPase 0.0000378
Further Details:      
 
Domain Number 2 Region: 357-463
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.11e-23
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 213-318
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000000012
Family MesJ substrate recognition domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261876168|ref|YP_697160.2|
Sequence length 469
Comment tRNA(Ile)-lysidine synthetase [Clostridium perfringens ATCC 13124]
Sequence
MKKKVIDFIKENSMIKNGDKVLVALSGGPDSVCLLHILSELRELLHIEVYAAHVNHCLRG
ESALKDEAYVEELCKNLNIKCFVKRVDINKISEEQNISTEMAGREERYKFFEELKNEYSL
DKIAIAHNANDQAETLIMRALRGTGIEGLVGIKPVRDGIFIRPILILRRKEIEEYCEINN
LNPRIDETNLEEIYSRNKIRLKAIPFIEENFNPDIVATLNRLAYSCSKDVEFIQEEVEKR
FPKLCIKENHSILIKEEAFNEKEALLTRIIKKALFEVSSKHNNFELKHIQDIIALKDKGT
GKQINITNGVIALNEYGDIRIKLVDSKKAKENKVLNLENIKDELDKNQKVVIEDDILGNY
ELIVEDLKKGEKFSKDRFIKSFDYDKISNIDIRFRQNGDKIIPLGMKSSKKLKDIFINNK
IPKEERDFIPLVLFNNEIAWIVGSNVSETFKVTNKTKKVIKITFKGKEN
Download sequence
Identical sequences A0A174G031 Q0TMI0
WP_003479285.1.22226 WP_003479285.1.50147 WP_003479285.1.51349 WP_003479285.1.5667 WP_003479285.1.81392 195103.CPF_2788 gi|261876168|ref|YP_697160.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]