SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116871602|ref|YP_848383.1| from Listeria welshimeri serovar 6b str. SLCC5334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116871602|ref|YP_848383.1|
Domain Number 1 Region: 455-646
Classification Level Classification E-value
Superfamily PRTase-like 4.98e-60
Family Phosphoribosyltransferases (PRTases) 0.00000349
Further Details:      
 
Domain Number 2 Region: 9-240
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.38e-57
Family PP-loop ATPase 0.00013
Further Details:      
 
Domain Number 3 Region: 338-444
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.14e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.013
Further Details:      
 
Domain Number 4 Region: 217-325
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000366
Family MesJ substrate recognition domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116871602|ref|YP_848383.1|
Sequence length 648
Comment hypothetical protein lwe0182 [Listeria welshimeri serovar 6b str. SLCC5334]
Sequence
MEDIVKRTHKYIEKHDLIRSDDKLLVAVSGGPDSFALLHFLWSSKLVPKESISVAHLNHC
LREGAEKEQLVVQTFCEEHHIPFFVEAVDIKKHAETIQKGIEETARIVRYKFFEKVMTEN
DINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKRKVTKGYAIRPFLPITKAEIIQY
ASKHDLPYEIDESNVSQEYTRNRYRTQLLPFLSKENPAVYDHFNRFSEETSEDFLFLEEL
ANDVLKKNLIQNGKQTTLLLSSFKNEANPLQRRAIHLLLRYLYNDDTRIITVNHIYQIIQ
MIQSENPSSSIDLPKKLTAIRSYNELHFQFGERHAPSEFYHQLEINDRIELDDKTSIRLK
LKSSVVQTNGLNGMLLDAEDITLPLIVRNRVNGDRMTMKGQVGSKKLKDIFIDAKIPRQE
RDNLPVITDYTGKILWVPGVKKSAYDREFSRSKKQYIIRYTRNIGGNESMHNDIQKVLIS
EDELQEKIRELGRELTTEYEGRNPLVVGVLKGATPFMTDLLKRVDTYLEMDFMDVSSYGN
GTVSSGEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTLLDKP
AGRNVAIEADYVGFVVPNEFVVGYGLDYAERYRNLPYIGVLKPEIYSE
Download sequence
Identical sequences A0AF18
gi|116871602|ref|YP_848383.1| 386043.lwe0182 WP_011701046.1.63932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]