SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116873255|ref|YP_850036.1| from Listeria welshimeri serovar 6b str. SLCC5334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116873255|ref|YP_850036.1|
Domain Number 1 Region: 7-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-83
Family Protein kinases, catalytic subunit 0.00000112
Further Details:      
 
Weak hits

Sequence:  gi|116873255|ref|YP_850036.1|
Domain Number - Region: 506-564
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000327
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 367-428
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116873255|ref|YP_850036.1|
Sequence length 655
Comment protein kinase [Listeria welshimeri serovar 6b str. SLCC5334]
Sequence
MMIGKRLNDRYKILHAIGGGGMANVYLAHDMILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSIYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKSVDIMLQIVS
AVTVAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQAEIPSAREQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKERLNEPKYIFPTDDGDTKTIPIIATKE
AMQNLDKTIVPEGKVAAQEVASDATKGKKKKKMSKKKKIAWIVFSVIIVFIIGILLLWLL
GKSPDEIAVPDVSGKTEDQAIALLQKEGFVIGKTAEKNSDEVEEGKVINSDPEAGEMKEK
GTKVNLFVSIGSKKITLDDYSGRSYSDTKALLEEQGFESISAEEEYSSDVDKGMIISQTP
SGGSEVVAKSTSVKFVVSKGAEPISLKDLRGYTKTAVEDYASPLGFKVSSTEENSSSVEK
GQVISQSPSAGTTMNPGDTIQIVISAGPKEKEVKEVTKTFNIPYTPSDEENPEPQHIQIY
IQDKDHSMTSAYREMDISQNTSVEVTFKIEEGSSGGYKIISDDKVIDEGTVPYPN
Download sequence
Identical sequences A0AJS5
gi|116873255|ref|YP_850036.1| WP_011702609.1.63932 386043.lwe1839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]