SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146320557|ref|YP_001200268.1| from Streptococcus suis 98HAH33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146320557|ref|YP_001200268.1|
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.14e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146320557|ref|YP_001200268.1|
Sequence length 107
Comment phosphotransferase system cellobiose-specific component IIA [Streptococcus suis 98HAH33]
Sequence
MEMIVADQLIMGLIIYAGDAKSHAYQALSLVKAGEEERAEEELELADAALLEAHNMQTKF
LAQEAGGAKSDITALFVHSQDHLMTSITEINLIKEIIDLRKELKKVG
Download sequence
Identical sequences A0A075SIJ4 A0A0H3MVP1 A0A123SZR4 A4VU86 D5AH41
gi|386587929|ref|YP_006084330.1| gi|253751512|ref|YP_003024653.1| gi|253753413|ref|YP_003026554.1| gi|386581692|ref|YP_006078096.1| gi|403061332|ref|YP_006649548.1| 218494.SSU0664 391295.SSU05_0709 391296.SSU98_0710 568813.SSUSC84_0630 568814.SSUBM407_1167 gi|386577692|ref|YP_006074098.1| WP_011922241.1.10007 WP_011922241.1.100280 WP_011922241.1.100404 WP_011922241.1.100490 WP_011922241.1.100670 WP_011922241.1.100904 WP_011922241.1.100908 WP_011922241.1.101097 WP_011922241.1.101179 WP_011922241.1.101295 WP_011922241.1.101621 WP_011922241.1.101658 WP_011922241.1.101706 WP_011922241.1.101794 WP_011922241.1.101901 WP_011922241.1.102003 WP_011922241.1.102038 WP_011922241.1.10265 WP_011922241.1.1035 WP_011922241.1.10700 WP_011922241.1.10896 WP_011922241.1.10904 WP_011922241.1.11017 WP_011922241.1.11330 WP_011922241.1.11527 WP_011922241.1.11548 WP_011922241.1.11662 WP_011922241.1.11845 WP_011922241.1.11869 WP_011922241.1.11874 WP_011922241.1.1200 WP_011922241.1.12022 WP_011922241.1.12228 WP_011922241.1.12288 WP_011922241.1.12368 WP_011922241.1.1244 WP_011922241.1.12606 WP_011922241.1.12665 WP_011922241.1.12803 WP_011922241.1.12908 WP_011922241.1.13095 WP_011922241.1.13153 WP_011922241.1.1324 WP_011922241.1.13380 WP_011922241.1.13633 WP_011922241.1.13861 WP_011922241.1.1405 WP_011922241.1.14202 WP_011922241.1.14210 WP_011922241.1.1424 WP_011922241.1.1434 WP_011922241.1.14359 WP_011922241.1.14903 WP_011922241.1.1495 WP_011922241.1.15393 WP_011922241.1.15414 WP_011922241.1.15545 WP_011922241.1.15756 WP_011922241.1.15813 WP_011922241.1.1608 WP_011922241.1.16193 WP_011922241.1.16255 WP_011922241.1.16271 WP_011922241.1.1629 WP_011922241.1.16498 WP_011922241.1.16643 WP_011922241.1.16677 WP_011922241.1.16683 WP_011922241.1.16773 WP_011922241.1.16829 WP_011922241.1.16881 WP_011922241.1.17264 WP_011922241.1.17670 WP_011922241.1.17749 WP_011922241.1.17814 WP_011922241.1.17824 WP_011922241.1.17958 WP_011922241.1.17989 WP_011922241.1.1810 WP_011922241.1.18271 WP_011922241.1.18341 WP_011922241.1.18403 WP_011922241.1.18563 WP_011922241.1.18711 WP_011922241.1.18850 WP_011922241.1.19016 WP_011922241.1.19145 WP_011922241.1.19352 WP_011922241.1.19378 WP_011922241.1.1953 WP_011922241.1.19757 WP_011922241.1.19865 WP_011922241.1.19898 WP_011922241.1.20400 WP_011922241.1.20518 WP_011922241.1.20584 WP_011922241.1.20756 WP_011922241.1.20792 WP_011922241.1.20944 WP_011922241.1.20963 WP_011922241.1.21072 WP_011922241.1.21347 WP_011922241.1.21374 WP_011922241.1.21457 WP_011922241.1.21688 WP_011922241.1.21793 WP_011922241.1.21903 WP_011922241.1.22347 WP_011922241.1.22785 WP_011922241.1.22848 WP_011922241.1.22882 WP_011922241.1.23089 WP_011922241.1.23273 WP_011922241.1.23317 WP_011922241.1.23358 WP_011922241.1.23682 WP_011922241.1.23965 WP_011922241.1.24078 WP_011922241.1.24150 WP_011922241.1.24175 WP_011922241.1.24187 WP_011922241.1.24208 WP_011922241.1.24431 WP_011922241.1.24858 WP_011922241.1.24883 WP_011922241.1.25245 WP_011922241.1.25280 WP_011922241.1.25381 WP_011922241.1.25396 WP_011922241.1.25617 WP_011922241.1.25711 WP_011922241.1.25798 WP_011922241.1.25824 WP_011922241.1.25950 WP_011922241.1.26009 WP_011922241.1.26302 WP_011922241.1.26324 WP_011922241.1.26368 WP_011922241.1.26507 WP_011922241.1.26620 WP_011922241.1.27108 WP_011922241.1.27225 WP_011922241.1.27227 WP_011922241.1.27296 WP_011922241.1.27381 WP_011922241.1.27476 WP_011922241.1.27695 WP_011922241.1.27754 WP_011922241.1.27760 WP_011922241.1.27767 WP_011922241.1.28000 WP_011922241.1.28033 WP_011922241.1.28099 WP_011922241.1.28244 WP_011922241.1.28467 WP_011922241.1.28645 WP_011922241.1.28796 WP_011922241.1.28805 WP_011922241.1.28908 WP_011922241.1.29141 WP_011922241.1.29299 WP_011922241.1.29545 WP_011922241.1.29610 WP_011922241.1.29635 WP_011922241.1.29935 WP_011922241.1.30079 WP_011922241.1.30136 WP_011922241.1.30241 WP_011922241.1.30344 WP_011922241.1.30414 WP_011922241.1.30562 WP_011922241.1.30785 WP_011922241.1.31254 WP_011922241.1.31597 WP_011922241.1.31707 WP_011922241.1.31730 WP_011922241.1.31763 WP_011922241.1.32048 WP_011922241.1.32258 WP_011922241.1.32259 WP_011922241.1.32292 WP_011922241.1.32332 WP_011922241.1.32466 WP_011922241.1.32630 WP_011922241.1.32947 WP_011922241.1.33254 WP_011922241.1.33330 WP_011922241.1.33471 WP_011922241.1.34222 WP_011922241.1.34321 WP_011922241.1.34425 WP_011922241.1.34527 WP_011922241.1.34652 WP_011922241.1.34738 WP_011922241.1.34895 WP_011922241.1.35430 WP_011922241.1.35551 WP_011922241.1.35675 WP_011922241.1.35725 WP_011922241.1.35749 WP_011922241.1.36136 WP_011922241.1.36153 WP_011922241.1.36251 WP_011922241.1.36341 WP_011922241.1.36437 WP_011922241.1.36611 WP_011922241.1.36766 WP_011922241.1.36945 WP_011922241.1.37126 WP_011922241.1.37237 WP_011922241.1.376 WP_011922241.1.37653 WP_011922241.1.37688 WP_011922241.1.37816 WP_011922241.1.37841 WP_011922241.1.37915 WP_011922241.1.38409 WP_011922241.1.38470 WP_011922241.1.38936 WP_011922241.1.39011 WP_011922241.1.39023 WP_011922241.1.39247 WP_011922241.1.39280 WP_011922241.1.39714 WP_011922241.1.3989 WP_011922241.1.40062 WP_011922241.1.40141 WP_011922241.1.40228 WP_011922241.1.40265 WP_011922241.1.40384 WP_011922241.1.40507 WP_011922241.1.4074 WP_011922241.1.40802 WP_011922241.1.41046 WP_011922241.1.41052 WP_011922241.1.41280 WP_011922241.1.41340 WP_011922241.1.41522 WP_011922241.1.41854 WP_011922241.1.42206 WP_011922241.1.42323 WP_011922241.1.42552 WP_011922241.1.42596 WP_011922241.1.42732 WP_011922241.1.42735 WP_011922241.1.4278 WP_011922241.1.42784 WP_011922241.1.42827 WP_011922241.1.42840 WP_011922241.1.4291 WP_011922241.1.43193 WP_011922241.1.43264 WP_011922241.1.43288 WP_011922241.1.43482 WP_011922241.1.43813 WP_011922241.1.43922 WP_011922241.1.43963 WP_011922241.1.43977 WP_011922241.1.44047 WP_011922241.1.44128 WP_011922241.1.44592 WP_011922241.1.44676 WP_011922241.1.44778 WP_011922241.1.45088 WP_011922241.1.45216 WP_011922241.1.45219 WP_011922241.1.45278 WP_011922241.1.4529 WP_011922241.1.45345 WP_011922241.1.45864 WP_011922241.1.45936 WP_011922241.1.467 WP_011922241.1.46880 WP_011922241.1.47315 WP_011922241.1.47375 WP_011922241.1.47434 WP_011922241.1.4748 WP_011922241.1.4757 WP_011922241.1.47643 WP_011922241.1.47745 WP_011922241.1.47894 WP_011922241.1.47900 WP_011922241.1.48167 WP_011922241.1.48217 WP_011922241.1.48397 WP_011922241.1.4858 WP_011922241.1.48583 WP_011922241.1.48603 WP_011922241.1.49093 WP_011922241.1.49099 WP_011922241.1.49206 WP_011922241.1.49255 WP_011922241.1.49368 WP_011922241.1.49413 WP_011922241.1.49509 WP_011922241.1.49782 WP_011922241.1.49968 WP_011922241.1.50047 WP_011922241.1.50127 WP_011922241.1.5021 WP_011922241.1.50437 WP_011922241.1.50538 WP_011922241.1.50551 WP_011922241.1.50675 WP_011922241.1.50751 WP_011922241.1.5079 WP_011922241.1.50798 WP_011922241.1.51155 WP_011922241.1.51263 WP_011922241.1.51386 WP_011922241.1.51551 WP_011922241.1.52159 WP_011922241.1.52175 WP_011922241.1.52490 WP_011922241.1.52572 WP_011922241.1.52599 WP_011922241.1.52628 WP_011922241.1.52798 WP_011922241.1.53030 WP_011922241.1.53174 WP_011922241.1.53290 WP_011922241.1.53309 WP_011922241.1.534 WP_011922241.1.5344 WP_011922241.1.53448 WP_011922241.1.53487 WP_011922241.1.53749 WP_011922241.1.53805 WP_011922241.1.53918 WP_011922241.1.54000 WP_011922241.1.5404 WP_011922241.1.54184 WP_011922241.1.54384 WP_011922241.1.54447 WP_011922241.1.54488 WP_011922241.1.54535 WP_011922241.1.54683 WP_011922241.1.54800 WP_011922241.1.54828 WP_011922241.1.55064 WP_011922241.1.55137 WP_011922241.1.55158 WP_011922241.1.55649 WP_011922241.1.55687 WP_011922241.1.55714 WP_011922241.1.5579 WP_011922241.1.55815 WP_011922241.1.55833 WP_011922241.1.55834 WP_011922241.1.55864 WP_011922241.1.55924 WP_011922241.1.56077 WP_011922241.1.56140 WP_011922241.1.56150 WP_011922241.1.56215 WP_011922241.1.56434 WP_011922241.1.56463 WP_011922241.1.56762 WP_011922241.1.57067 WP_011922241.1.5714 WP_011922241.1.57164 WP_011922241.1.57189 WP_011922241.1.5754 WP_011922241.1.57640 WP_011922241.1.57674 WP_011922241.1.57767 WP_011922241.1.57810 WP_011922241.1.57938 WP_011922241.1.58077 WP_011922241.1.58229 WP_011922241.1.58517 WP_011922241.1.58566 WP_011922241.1.58585 WP_011922241.1.58706 WP_011922241.1.58725 WP_011922241.1.58746 WP_011922241.1.58793 WP_011922241.1.58815 WP_011922241.1.58903 WP_011922241.1.59071 WP_011922241.1.59138 WP_011922241.1.59144 WP_011922241.1.59283 WP_011922241.1.59349 WP_011922241.1.5936 WP_011922241.1.59524 WP_011922241.1.59647 WP_011922241.1.59702 WP_011922241.1.5974 WP_011922241.1.59929 WP_011922241.1.60233 WP_011922241.1.60237 WP_011922241.1.60293 WP_011922241.1.60377 WP_011922241.1.60445 WP_011922241.1.60658 WP_011922241.1.60659 WP_011922241.1.60853 WP_011922241.1.60862 WP_011922241.1.609 WP_011922241.1.61370 WP_011922241.1.61533 WP_011922241.1.61540 WP_011922241.1.6156 WP_011922241.1.6165 WP_011922241.1.61782 WP_011922241.1.61885 WP_011922241.1.6223 WP_011922241.1.62268 WP_011922241.1.62485 WP_011922241.1.62497 WP_011922241.1.62587 WP_011922241.1.6278 WP_011922241.1.62805 WP_011922241.1.62884 WP_011922241.1.63018 WP_011922241.1.63168 WP_011922241.1.63318 WP_011922241.1.63653 WP_011922241.1.63685 WP_011922241.1.63959 WP_011922241.1.64009 WP_011922241.1.64120 WP_011922241.1.64128 WP_011922241.1.64273 WP_011922241.1.64281 WP_011922241.1.64384 WP_011922241.1.64641 WP_011922241.1.64797 WP_011922241.1.64952 WP_011922241.1.65024 WP_011922241.1.65047 WP_011922241.1.65161 WP_011922241.1.65174 WP_011922241.1.65184 WP_011922241.1.65314 WP_011922241.1.65422 WP_011922241.1.65458 WP_011922241.1.65905 WP_011922241.1.65911 WP_011922241.1.65917 WP_011922241.1.6596 WP_011922241.1.66185 WP_011922241.1.66186 WP_011922241.1.66472 WP_011922241.1.66521 WP_011922241.1.66590 WP_011922241.1.66609 WP_011922241.1.66707 WP_011922241.1.6686 WP_011922241.1.66954 WP_011922241.1.67058 WP_011922241.1.67109 WP_011922241.1.6711 WP_011922241.1.67256 WP_011922241.1.67338 WP_011922241.1.67488 WP_011922241.1.677 WP_011922241.1.67883 WP_011922241.1.67897 WP_011922241.1.67958 WP_011922241.1.67962 WP_011922241.1.68010 WP_011922241.1.68303 WP_011922241.1.68602 WP_011922241.1.68666 WP_011922241.1.68739 WP_011922241.1.68791 WP_011922241.1.68941 WP_011922241.1.69115 WP_011922241.1.69161 WP_011922241.1.69167 WP_011922241.1.69413 WP_011922241.1.69454 WP_011922241.1.6967 WP_011922241.1.69698 WP_011922241.1.69706 WP_011922241.1.69910 WP_011922241.1.69922 WP_011922241.1.70033 WP_011922241.1.70102 WP_011922241.1.70387 WP_011922241.1.70403 WP_011922241.1.70817 WP_011922241.1.70832 WP_011922241.1.70997 WP_011922241.1.71125 WP_011922241.1.71140 WP_011922241.1.71425 WP_011922241.1.71432 WP_011922241.1.71462 WP_011922241.1.71498 WP_011922241.1.71727 WP_011922241.1.71911 WP_011922241.1.71914 WP_011922241.1.72174 WP_011922241.1.72247 WP_011922241.1.72296 WP_011922241.1.72413 WP_011922241.1.7257 WP_011922241.1.72611 WP_011922241.1.73011 WP_011922241.1.73262 WP_011922241.1.73280 WP_011922241.1.73299 WP_011922241.1.73679 WP_011922241.1.73721 WP_011922241.1.73905 WP_011922241.1.74090 WP_011922241.1.74132 WP_011922241.1.74554 WP_011922241.1.74567 WP_011922241.1.74800 WP_011922241.1.74843 WP_011922241.1.74865 WP_011922241.1.75022 WP_011922241.1.75028 WP_011922241.1.75605 WP_011922241.1.75930 WP_011922241.1.75965 WP_011922241.1.75985 WP_011922241.1.76083 WP_011922241.1.76175 WP_011922241.1.76400 WP_011922241.1.76735 WP_011922241.1.76808 WP_011922241.1.76907 WP_011922241.1.77006 WP_011922241.1.7754 WP_011922241.1.77616 WP_011922241.1.77624 WP_011922241.1.7763 WP_011922241.1.77781 WP_011922241.1.77795 WP_011922241.1.77958 WP_011922241.1.78326 WP_011922241.1.78456 WP_011922241.1.7873 WP_011922241.1.78744 WP_011922241.1.78792 WP_011922241.1.7889 WP_011922241.1.78945 WP_011922241.1.79054 WP_011922241.1.79154 WP_011922241.1.79162 WP_011922241.1.79499 WP_011922241.1.79610 WP_011922241.1.79644 WP_011922241.1.79679 WP_011922241.1.80097 WP_011922241.1.80131 WP_011922241.1.80153 WP_011922241.1.80169 WP_011922241.1.80216 WP_011922241.1.80235 WP_011922241.1.80418 WP_011922241.1.8061 WP_011922241.1.80716 WP_011922241.1.80742 WP_011922241.1.80787 WP_011922241.1.8083 WP_011922241.1.80952 WP_011922241.1.81103 WP_011922241.1.81370 WP_011922241.1.81513 WP_011922241.1.81584 WP_011922241.1.81705 WP_011922241.1.82122 WP_011922241.1.82418 WP_011922241.1.8251 WP_011922241.1.82830 WP_011922241.1.82870 WP_011922241.1.82977 WP_011922241.1.83087 WP_011922241.1.8344 WP_011922241.1.83818 WP_011922241.1.83915 WP_011922241.1.8414 WP_011922241.1.84389 WP_011922241.1.84412 WP_011922241.1.84489 WP_011922241.1.8451 WP_011922241.1.84535 WP_011922241.1.85051 WP_011922241.1.85075 WP_011922241.1.8514 WP_011922241.1.85327 WP_011922241.1.85437 WP_011922241.1.85450 WP_011922241.1.85908 WP_011922241.1.86151 WP_011922241.1.86177 WP_011922241.1.86817 WP_011922241.1.86836 WP_011922241.1.86842 WP_011922241.1.87044 WP_011922241.1.87321 WP_011922241.1.87344 WP_011922241.1.87438 WP_011922241.1.87450 WP_011922241.1.87819 WP_011922241.1.87874 WP_011922241.1.87885 WP_011922241.1.8790 WP_011922241.1.88201 WP_011922241.1.88543 WP_011922241.1.88575 WP_011922241.1.88635 WP_011922241.1.88653 WP_011922241.1.88779 WP_011922241.1.89037 WP_011922241.1.89038 WP_011922241.1.89056 WP_011922241.1.89128 WP_011922241.1.89156 WP_011922241.1.89279 WP_011922241.1.89358 WP_011922241.1.89388 WP_011922241.1.89800 WP_011922241.1.8993 WP_011922241.1.89981 WP_011922241.1.89989 WP_011922241.1.90172 WP_011922241.1.90419 WP_011922241.1.90742 WP_011922241.1.90917 WP_011922241.1.90961 WP_011922241.1.91004 WP_011922241.1.91238 WP_011922241.1.91636 WP_011922241.1.91865 WP_011922241.1.91912 WP_011922241.1.91973 WP_011922241.1.91983 WP_011922241.1.92134 WP_011922241.1.92263 WP_011922241.1.92441 WP_011922241.1.92554 WP_011922241.1.92692 WP_011922241.1.92722 WP_011922241.1.928 WP_011922241.1.92964 WP_011922241.1.93190 WP_011922241.1.93220 WP_011922241.1.93456 WP_011922241.1.93519 WP_011922241.1.9361 WP_011922241.1.93627 WP_011922241.1.93646 WP_011922241.1.9376 WP_011922241.1.93771 WP_011922241.1.94332 WP_011922241.1.94338 WP_011922241.1.94418 WP_011922241.1.94419 WP_011922241.1.94449 WP_011922241.1.9454 WP_011922241.1.94639 WP_011922241.1.94786 WP_011922241.1.94945 WP_011922241.1.95180 WP_011922241.1.95213 WP_011922241.1.95214 WP_011922241.1.95262 WP_011922241.1.95288 WP_011922241.1.95351 WP_011922241.1.95542 WP_011922241.1.95788 WP_011922241.1.9594 WP_011922241.1.96021 WP_011922241.1.96164 WP_011922241.1.96282 WP_011922241.1.96427 WP_011922241.1.96451 WP_011922241.1.9652 WP_011922241.1.96524 WP_011922241.1.96574 WP_011922241.1.96700 WP_011922241.1.96973 WP_011922241.1.97052 WP_011922241.1.97453 WP_011922241.1.97493 WP_011922241.1.97504 WP_011922241.1.97515 WP_011922241.1.97554 WP_011922241.1.97857 WP_011922241.1.9809 WP_011922241.1.9815 WP_011922241.1.98253 WP_011922241.1.98271 WP_011922241.1.98326 WP_011922241.1.98343 WP_011922241.1.98416 WP_011922241.1.98464 WP_011922241.1.98860 WP_011922241.1.98864 WP_011922241.1.98921 WP_011922241.1.98999 WP_011922241.1.99127 WP_011922241.1.9922 WP_011922241.1.99252 WP_011922241.1.99324 WP_011922241.1.9956 WP_011922241.1.99696 WP_011922241.1.99988 YP_003028899.1.79686 gi|253755759|ref|YP_003028899.1| gi|386579749|ref|YP_006076154.1| gi|146320557|ref|YP_001200268.1| gi|146318363|ref|YP_001198075.1| gi|476419722|ref|YP_007570718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]