SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146321897|ref|YP_001201608.1| from Streptococcus suis 98HAH33

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146321897|ref|YP_001201608.1|
Domain Number 1 Region: 10-235
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.28e-40
Family Protein serine/threonine phosphatase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146321897|ref|YP_001201608.1|
Sequence length 256
Comment Serine/threonine protein phosphatase [Streptococcus suis 98HAH33]
Sequence
MLIKCGRIESMKKEFFVIGDVHGKFELLLDILKKWNEKRQQLIFLGDLIDRGENSKACLE
LVWSLVREKGAICLTGNHERMFLAWLRDPIDRYDHYRRNGGDTTINSLLGRPLDAPVDGL
VDANAVLEQYEDLIDFVKSCPYHLETEDYIFVHAGVDLTLPDWRETSNHDKVWLRTPFHE
AENTTGKMIVFGHTPVYNLYQTKLRISQIWTSPDGKMGIDGGAVYGGVLHGIVLDGTGLV
QDYIVGAVNPRKEIED
Download sequence
Identical sequences A4VY27 D5AES4
gi|146321897|ref|YP_001201608.1| 391295.SSU05_2050 391296.SSU98_2050 gi|386578853|ref|YP_006075259.1| gi|146319704|ref|YP_001199416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]