SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521465360|ref|YP_008152576.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521465360|ref|YP_008152576.1|
Domain Number 1 Region: 668-826
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-34
Family Histidine kinase 0.0027
Further Details:      
 
Domain Number 2 Region: 21-156
Classification Level Classification E-value
Superfamily CheY-like 4.13e-32
Family CheY-related 0.005
Further Details:      
 
Domain Number 3 Region: 481-593
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-27
Family Flavin-binding PAS domain 0.023
Further Details:      
 
Domain Number 4 Region: 301-452
Classification Level Classification E-value
Superfamily GAF domain-like 1.68e-19
Family GAF domain 0.0034
Further Details:      
 
Domain Number 5 Region: 154-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 6 Region: 596-675
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000157
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|521465360|ref|YP_008152576.1|
Sequence length 836
Comment hypothetical protein SCE1572_30950 [Sorangium cellulosum So0157-2]
Sequence
MKAPLQPGAPLPTTPSEPVASILLVDDHRPNLLALEAVLDPLRQRLVTAQSGEEALEHLS
REEFALILMDVKMRGIDGFETAARVRGLDRARHTPIIFISGLPEDEDRLYRGYREGAVDY
VVKPFNPDILRAKVAVFVELHRRAEQIKRQEAALRELERQASDEVFRRIMDTSMMGLLFS
DYEGRVLEANDCFLSMVGYTREDIKAGLLTWQQLSPPEYEHVHHDAVNELSLRGATKQFE
KEYIRKDGKRVAVLVGSARIETQKRNLTYVLDISERKRAEANVSLLAGAGEILSSSLDFR
ETLGQLARLVVPLLADWCAVDIQAQEGGIQRVAVQHTDPAKVTLVRQIEEKYPVDPAASR
GVPKVLRTGETEWSSDIPDSLLVENARDEEHLRMARDLGLRSYLVVPLAARGRVLGAITL
AHAESGRRYTKADVQFAEELARRAALSVDNALLFEREVTVRKEVETLAEELKHSEAQFRL
LAETMPQLVWTNRPDGHHEYFNQRWYDYTGLTADDTGGEGWSRIIHPEEHERAIETWRQA
LRTGEPYESQCRLRRADGAYRWFIGRAVAARDGSGRIVRWFGTYTDIDDQKRAEEERQRL
VQALERSNKELDQFAYVTSHDLKAPLRGIANLSQWIEEDLNDKMTAESRKQLDLLRGRVH
RLENLIDGILSYSRAGRVREKPEAIDVGKLLREIVELLAPPPETRVEIAPDMPVLVTERA
PLQQTFLNLISNALKHAGRADPEVRIGARDAGPFWEFSVSDNGSGIAPEYHDRIWGIFQT
LKARDKVEGTGIGLSVVQKIVQSKGARAWVESAVGAGATFRFTWPKLEAREPSSPG
Download sequence
Identical sequences S4Y216
gi|521465360|ref|YP_008152576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]