SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113869567|ref|YP_728056.1| from Ralstonia eutropha H16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113869567|ref|YP_728056.1|
Domain Number 1 Region: 636-1113
Classification Level Classification E-value
Superfamily ALDH-like 3.8e-130
Family ALDH-like 0.000000275
Further Details:      
 
Domain Number 2 Region: 262-618
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.84e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000234
Further Details:      
 
Domain Number 3 Region: 88-261
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.48e-65
Family N-terminal domain of bifunctional PutA protein 0.000000155
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000156
Family PutA pre-N-terminal region-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113869567|ref|YP_728056.1|
Sequence length 1321
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ralstonia eutropha H16]
Sequence
MATTTLGVKLDDASRDRLKRVAQSIDRTPHWLIKQAIFTYLEQIERGHLPHETGAAGSAD
ADGADGAELVHGDAPQPFLEFAQSIQPQSVLRAAITSAYRRPEADCVPVLLEQARLPQQQ
GEAAIKMAKTLATRLREQKVGSGREGLVQGLIQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISGANWQSHLGQSPSLFVNAATWGLLLTGKLVATHTESGLTKALTRIIGKGG
EPLIRKGVDMAMRLMGEQFVTGETISEALANARKYEAEGFRYSYDMLGEAAMTEADAQRY
LASYEQAIHAIGQASRGRGIYEGPGISIKLSALHPRYSRAQHERVVGELYERLKSLTLLA
RQYDIGINIDAEEADRLEISLDLLERLCFEPELAGWNGIGFVVQGYQKRCPFVIDYLIDL
ARRSRHRLMIRLVKGAYWDSEIKRAQLDGLEGYPVYTRKVYTDVSYIACARKLLSVPDAI
YPQFATHNAHTLSAIYQIAGHSYYPGQYEFQCLHGMGEPLYDQVVGATADGKFNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADDTISLDELVADPVAVVEAMHREEGVLGL
PHPRIPSPRTLYGKSRPNSAGIDLANEHRLASLSSALLAGTSERFVAEPLLGAEVPRAAD
AITTPVLNPADHRDVVGHVTEAGQAEVDAALQAAINAAPIWQATPPDVRAAALERAADLM
EAQMQSLMGIIMREAGKTFSNAIAEVREAVDFLRYYAAEVRRSFDNETHRPLGPVVCISP
WNFPLAIFTGQVAAALAAGNPVLAKPAEQTPLIAAAAVRLLREAGVPAGAVQLLPGRGET
VGAALVGDARVKGVMFTGSTEVARILQRNVAGRLDAAGRPIPLIAETGGQNAMIVDSSAL
AEQVVGDVLSSAFDSAGQRCSALRVLCLQEDVADRVLEMLKGAMQELNMANPDRLSTDVG
PVIDDEARGNIVRHVDAMRAKGRRVHQADPNAAQGASCRNGTFVPPTLIELDSIEELKRE
VFGPVLHVVRFPRAALDTMVSQINATGYGLTLGIHTRIDETISHIVSRAHVGNLYVNRNI
VGAVVGVQPFGGEGLSGTGPKAGGPLYLHRLLSVCPQDAVVRSVRASEAGGGAEAATLRD
EAAAAFQAWARAELPAVAAACERLAEASPSGLTVTLPGPTGERNTYTLLPREHVLCLATQ
EADLALQLGAVLTVGADAVWPENPVSRGLFARLPKGVQSRVRMVADWTAADIAIDAVLHH
GDSDQLRTVCEQVAVRPGPIIGVQALAQGEPNIALDRLLIERSLSVNTAAAGGNASLMTI
G
Download sequence
Identical sequences Q0K5N3
381666.H16_A3631 gi|113869567|ref|YP_728056.1| WP_011616226.1.70127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]