SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116694032|ref|YP_728243.1| from Ralstonia eutropha H16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116694032|ref|YP_728243.1|
Domain Number 1 Region: 16-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 5.36e-80
Family Acetamidase/Formamidase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116694032|ref|YP_728243.1|
Sequence length 410
Comment formamidase [Ralstonia eutropha H16]
Sequence
MTDTLIKVDLAESPYENPNVHNRWHPDIPMACWVKPGDDFILETYDWTGGFIKNNDSADD
VRDIDLSIVHFLSGPVGVEGAEPGDLLVVDLLDIGARPESQWGFNGFFSKQNGGGFLTDH
FPQAQKSIWDFHGLYTSSRHIPGVSFAGLIHPGLIGCLPDQAMLETWNKREMDFIATDPG
RVPPLANPPFAATAHMGRLQGDARAQAAAAGARTVPPREHGGNCDIKDLSRGAKVYFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMRVSLIKGGMAKYGIRNPIFKPSPITP
SYNDYLIFEGISVDESGKQHYLDVHVAYRQACLNAIEYLSRFGYSRAQAYSILGTAPVQG
HISGVVDIPNACATLWLPTQIFDFDIRPNASGPVKMIQGGVDLPLSPDLA
Download sequence
Identical sequences Q0K546 R7XBV4
381666.H16_B0072 WP_010814081.1.2820 WP_010814081.1.5264 WP_010814081.1.6206 WP_010814081.1.70127 WP_010814081.1.97491 gi|116694032|ref|YP_728243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]