SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113869604|ref|YP_728093.1| from Ralstonia eutropha H16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113869604|ref|YP_728093.1|
Domain Number 1 Region: 501-521,562-806
Classification Level Classification E-value
Superfamily HAD-like 8.64e-57
Family Meta-cation ATPase, catalytic domain P 0.00049
Further Details:      
 
Domain Number 2 Region: 306-403
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.58e-28
Family Calcium ATPase, transduction domain A 0.0038
Further Details:      
 
Domain Number 3 Region: 88-155
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 2.88e-19
Family HMA, heavy metal-associated domain 0.00077
Further Details:      
 
Domain Number 4 Region: 15-84
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.44e-17
Family HMA, heavy metal-associated domain 0.00099
Further Details:      
 
Domain Number 5 Region: 273-307,404-496
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000157
Family Calcium ATPase, transmembrane domain M 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113869604|ref|YP_728093.1|
Sequence length 825
Comment copper uptake P-type ATPase [Ralstonia eutropha H16]
Sequence
MPNSSAVLASQPVRPADEMPEWRLPVDGMTCASCVRRVENALARVPGVRDVAVNLATEAA
TLRADSGAVLPAAARAVADAGYTVPQDTIGLNIADMTCASCVSRVEKALRAVPGVMEAQV
NLATERASVTLLRGAADTAALVAAVARAGYGATPVADAASQAPQAAQGTAFWDGPWPVAI
SAALSLPLVAPMVLEWLGVHWMLPAWVQWLLATPVQFVFGWRFYKAGWKAVRAGAGNMDL
LVALGTTAAYGLSLWLMWRTPADAMPHLYFESAAVVITLVRLGKWLETRAKRQTADAIRA
LAALRPDTARVRRGGVEQSVPLAAVRVGDEVVVRPGERIPVDAEVIEGNSHADESMLTGE
SVPVPKKPGDRITGGAINFEGLLVARTEAVGAETVLARIIRMVEHAQAAKAPIQRMVDQV
SAVFVPVVLGIALLTVLGWGLFAGDWETALLNAVAVLVIACPCALGLATPTAIMAGTGAG
ARAGILIKDAEALEVAHRVSVVAFDKTGTLTVGKPEVVALHAADPADADGSALLARLAAL
QAGSEHPLARAVLAAAQARGIAAPQATEVQALPGRGIAGVVDGQALQLGSERLREALGAA
AGTLATLAEQLRADGRTVSWLVETTLPRVAGLVAFGDAIKPGAPAAIARLRAAGVRTVML
TGDNAGAAARVAQALGLDDVQAEVLPEDKAARVQALGRDGAVVAMVGDGINDAPALAAAD
VGIAMSTGTDVAMHAAGITLMRGDPALVADALAVSHRTVRKIRQNLFWAFFYNVVGIPLA
AAGLLNPVVAGAAMAFSSVSVVSNALLLRRWRPQAGAATAQGGER
Download sequence
Identical sequences Q0K5J6
WP_011616242.1.2820 WP_011616242.1.70127 381666.H16_A3668 gi|113869604|ref|YP_728093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]