SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116695583|ref|YP_841159.1| from Ralstonia eutropha H16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116695583|ref|YP_841159.1|
Domain Number 1 Region: 474-493,531-782
Classification Level Classification E-value
Superfamily HAD-like 1.56e-52
Family Meta-cation ATPase, catalytic domain P 0.00059
Further Details:      
 
Domain Number 2 Region: 276-374
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.8e-23
Family Calcium ATPase, transduction domain A 0.0053
Further Details:      
 
Domain Number 3 Region: 224-277,375-466
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000000157
Family Calcium ATPase, transmembrane domain M 0.0066
Further Details:      
 
Domain Number 4 Region: 78-150
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000000154
Family HMA, heavy metal-associated domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116695583|ref|YP_841159.1|
Sequence length 791
Comment putative heavy metal efflux P-type ATPase [Ralstonia eutropha H16]
Sequence
MARTSPEDALPQDHAAHAHDGAAHRHGGHDHDHHHDHDHDHHGHGHAEARQAPAASACCG
GGCSSTVALTPAAPVDIPAGAQTAAWRIDAMDCPTEETLIRNKLGGMAGVAALEFNLIQR
VLTVHHTLPSAEPVARAIESLGMQPVPLSTEAAQQVLPQTTASKPWWPLALAGVAALGAE
AAEWLGLGLPWLPAVLALAAVALGGLTTYRKGWIALRNGNLNINALMSIAVTGALLLRQW
PEAAMVMVLFALAERIEAASLDRARNAIRGLMAMAPEQATVQRADGSWETVPAAGVAVGA
LVRLRPGERVALDGKVVRGQSALDQAPITGESVPVDKTEGDALFAGSINQSGELEYTVTA
PASDSTLARIIHAVEAAQGSRAPTQRFVDQFARIYTPTVFALALAVAVVPPLVMGGAWVD
WIYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEQGRHLAWVALDKTG
TITHGKPAQTNHALLAEDAPQARAIAASLAARSDHPVSRAVATAAAADGIGTLPVDDFEA
LAGRGTRGKVQGVAYCLGNHRLVHEMGACSPALEARLEALEREGKTVVLLARVDGHGAAT
ALALFAVADTVRDTSRQAIAELHELGVRTLMLSGDNPHTAQAIAAQVGIDEARGNQLPQD
KADGIAALAGAAHARGGRIGMVGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDD
DLRKIPAFVRLSRRTSGILTQNIALALGIKAVFLVLTVLGMGTMWMAVFADMGASLLVVF
NGLRVGAERRG
Download sequence
Identical sequences Q0K0P5
381666.H16_B1644 gi|116695583|ref|YP_841159.1| WP_011617370.1.2820 WP_011617370.1.70127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]