SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152972026|ref|YP_001337172.1| from Klebsiella pneumoniae subsp. pneumoniae MGH 78578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152972026|ref|YP_001337172.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.1e-108
Family FMN-linked oxidoreductases 0.0000000000634
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.41e-40
Family N-terminal domain of adrenodoxin reductase-like 0.0000015
Further Details:      
 
Domain Number 3 Region: 462-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152972026|ref|YP_001337172.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
Sequence
MSRYPSLFAPLELGFTTLKNRVLMGSMHTGLEELPDGAQRLAAFYAERARHGVALIVTGG
IAPAPSGVTMAGGAVLNDASHLAHHRHITDAVHQEGGKIALQILHTGRYSYQPALVAPSA
LQAPINRFTPHELSHDEILTLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDQWGGDYARRMRFAVEVVKAVRQRAGHDFIIIYRLSMLDLVNDGSTLAEVTELAKAIE
AAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGAVSIPLITTNRINDPQVAEDI
LARGDADMVSMARPFLADAEFISKAQDDRADQINTCIGCNQACLDRIFVGKITSCLVNPR
ACHETLMPVLPANAPKRLAVVGAGPAGLAFTVNAAARGHHVTLFDALPEIGGQFNIAKQI
PGKEEFHETLRYYRTMLDLHGVDLRLNTRVTADDLLAFDETILATGIAPRLPAIDGIDHP
KVLSYLDVLRDKAPVGAKVAIIGCGGIGFDTAMFLSQSGAATSQDIGEFCREWGIDTSLQ
TAGGLSAEGPQLSKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYEK
IDDEGLHVTIGGERQLLAVDQVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAAELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences A6TEC1
272620.KPN_03510 WP_015959046.1.18736 WP_015959046.1.26336 WP_015959046.1.38448 WP_015959046.1.49877 WP_015959046.1.96842 gi|152972026|ref|YP_001337172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]