SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152970427|ref|YP_001335536.1| from Klebsiella pneumoniae subsp. pneumoniae MGH 78578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152970427|ref|YP_001335536.1|
Domain Number 1 Region: 137-392
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.17e-60
Family D-glucarate dehydratase-like 0.00000184
Further Details:      
 
Domain Number 2 Region: 25-150
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.44e-31
Family Enolase N-terminal domain-like 0.00000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152970427|ref|YP_001335536.1|
Sequence length 393
Comment L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
Sequence
MAQTPVMDVGTKSYISHQEQKMTATVEQIESWIVDVPTIRPHKLSMTTMGCQSLVIVRLT
RSDGICGIGEATTIGGLSYGVESPEAISSAITHYLTPLLKGQPADNLNALTARMNGAIKG
NTFAKSAIETALLDAQGKALGLPVSALLGGALQTALPVLWTLASGDTAKDIAEGEKLLAE
GRHRAFKLKIGARELATDLRHTRAIVEALGDRASIRVDVNQAWDAATGAKGCRELAAMGV
DLIEQPVSAHDNAALVRLSQQIETAILADEAVATAYDGYQLAQQGFTGAYALKIAKAGGP
NSVLALARVAQAAGIGLYGGTMLEGTVGTVASLHAWSTLPLQWGTEMFGPLLLKDDIVSV
PLTFADGQVALPQTPGLGVELDEDKLHFYTRQP
Download sequence
Identical sequences A6T9N5
gi|152970427|ref|YP_001335536.1| 272620.KPN_01875 NYSGXRC-9450e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]