SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114566973|ref|YP_754127.1| from Syntrophomonas wolfei subsp. wolfei str. Goettingen

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114566973|ref|YP_754127.1|
Domain Number 1 Region: 163-352
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-56
Family Methylesterase CheB, C-terminal domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily CheY-like 1.85e-26
Family CheY-related 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114566973|ref|YP_754127.1|
Sequence length 353
Comment protein-glutamate methylesterase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
Sequence
MIKVLIADDSALMRKMLKQILESDPEIQVVGAARDGEDVVIKAREYRPDVVTMDVNMPKQ
DGITALQYIVNEEICPVLMVSSLTQEGAMTTFEALELGAFDFVGKPGGTVSSSSDMKKVA
AEIINKIRAAAQLKNRVVKRERLARGQRQPVVKKKAPPRPGREVTKAVAMGISTGGPKMI
YEVVPLIPPDINAALFLVQHMPPNFTPAYVKRLNEACQIEVIEARAGIKVEPGVLYVGSG
GRHLNLVKNTAGDVIIRLSSKPDHLFIPSVSVMMESVLKVFSNRTIGVLMTGMGNDGADS
MVNIRQAGGITIAESEESAIVFGMPGDAIKRGGAEIVVPIWNIAREIIRAVNR
Download sequence
Identical sequences Q0AWZ8
335541.Swol_1449 gi|114566973|ref|YP_754127.1| WP_011640855.1.101022 WP_011640855.1.6463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]